Cargando…

Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement

BACKGROUND: Dietary nucleotides, considered as antibiotics alternative, were shown to have positive effects on intestinal hyperaemia, systemic immunity, small-intestinal growth, and hepatic composition in pigs. However, there is no previous research on nucleotide supplementation in weanling pigs und...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Hanlin, Zhao, Pinyao, Lei, Yan, Li, Tianshui, Kim, InHo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4668697/
https://www.ncbi.nlm.nih.gov/pubmed/26635958
http://dx.doi.org/10.1186/s40104-015-0049-5
_version_ 1782404014067941376
author Li, Hanlin
Zhao, Pinyao
Lei, Yan
Li, Tianshui
Kim, InHo
author_facet Li, Hanlin
Zhao, Pinyao
Lei, Yan
Li, Tianshui
Kim, InHo
author_sort Li, Hanlin
collection PubMed
description BACKGROUND: Dietary nucleotides, considered as antibiotics alternative, were shown to have positive effects on intestinal hyperaemia, systemic immunity, small-intestinal growth, and hepatic composition in pigs. However, there is no previous research on nucleotide supplementation in weanling pigs under an oral challenged E. coli K88. Therefore, 2 experiments were conducted to investigate the effects of dietary nucleotides on weanling pig growth performance, nutrient digestibility, fecal score, and blood profile after being orally challenged with E. coli K88. METHODS: In Exp. 1, a total of 140 weanling pigs [8.33 ± 0.33 kg of body weight (BW), 28-d old] were used in this 42-d feeding trial. Pigs were distributed into 1 of 4 treatments, 5 pigs/pen (3 barrows and 2 gilts) and 7 pens/treatment. Treatments were a control basal diet (CON) or the CON supplemented with 150 (R150), 220 (R220), or 275 (R275) mg/kg to give the three treatment diets. In Exp. 2, 28 weanling pigs (BW = 8.40 ± 0.22 kg, 28-d old) were distributed into 1 of 4 treatments to give 1 pig/pen and 7 pens/treatment in a 42-d feeding and challenge trial. Dietary treatments were the same as in Exp. 1. On d 14, all those pigs (BW = 13.3 ± 0.15 kg, 42-d old) were orally dosed with 1.5 mL suspension containing 10(10) cfu/mL of E. coli K88. Twenty four hours after challenge, blood and excreta samples were collected from each pigs for analysis. Fecal scores were measured on d 7, 14, 21, and 28 of the study. RESULTS: In Exp. 1, overall BW, average daily gain (ADG), gain/feed (G/F) ratio, and nutrient digestibilities were lower (P < 0.05) in CON group compared with the nucleotides fed pigs. In Exp. 2, after challenge, IgA, IgM, and IGF-I were higher (P < 0.05) in the nucleotide groups compared with CON. However, the nucleotide groups had lower (P < 0.05) cortisol and TNF-α compared with CON. Fecal E. coli counts and fecal score for the nucleotide groups were lower (P < 0.05) than for CON. CONCLUSIONS: In conclusion, dietary nucleotides supplementation could improve growth performance, nutrient digestibility, immune status, microbial balance, reduce diarrhea, and provide protection against enterotoxigenic E. coli K88 infection in weanling pigs.
format Online
Article
Text
id pubmed-4668697
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-46686972015-12-04 Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement Li, Hanlin Zhao, Pinyao Lei, Yan Li, Tianshui Kim, InHo J Anim Sci Biotechnol Research BACKGROUND: Dietary nucleotides, considered as antibiotics alternative, were shown to have positive effects on intestinal hyperaemia, systemic immunity, small-intestinal growth, and hepatic composition in pigs. However, there is no previous research on nucleotide supplementation in weanling pigs under an oral challenged E. coli K88. Therefore, 2 experiments were conducted to investigate the effects of dietary nucleotides on weanling pig growth performance, nutrient digestibility, fecal score, and blood profile after being orally challenged with E. coli K88. METHODS: In Exp. 1, a total of 140 weanling pigs [8.33 ± 0.33 kg of body weight (BW), 28-d old] were used in this 42-d feeding trial. Pigs were distributed into 1 of 4 treatments, 5 pigs/pen (3 barrows and 2 gilts) and 7 pens/treatment. Treatments were a control basal diet (CON) or the CON supplemented with 150 (R150), 220 (R220), or 275 (R275) mg/kg to give the three treatment diets. In Exp. 2, 28 weanling pigs (BW = 8.40 ± 0.22 kg, 28-d old) were distributed into 1 of 4 treatments to give 1 pig/pen and 7 pens/treatment in a 42-d feeding and challenge trial. Dietary treatments were the same as in Exp. 1. On d 14, all those pigs (BW = 13.3 ± 0.15 kg, 42-d old) were orally dosed with 1.5 mL suspension containing 10(10) cfu/mL of E. coli K88. Twenty four hours after challenge, blood and excreta samples were collected from each pigs for analysis. Fecal scores were measured on d 7, 14, 21, and 28 of the study. RESULTS: In Exp. 1, overall BW, average daily gain (ADG), gain/feed (G/F) ratio, and nutrient digestibilities were lower (P < 0.05) in CON group compared with the nucleotides fed pigs. In Exp. 2, after challenge, IgA, IgM, and IGF-I were higher (P < 0.05) in the nucleotide groups compared with CON. However, the nucleotide groups had lower (P < 0.05) cortisol and TNF-α compared with CON. Fecal E. coli counts and fecal score for the nucleotide groups were lower (P < 0.05) than for CON. CONCLUSIONS: In conclusion, dietary nucleotides supplementation could improve growth performance, nutrient digestibility, immune status, microbial balance, reduce diarrhea, and provide protection against enterotoxigenic E. coli K88 infection in weanling pigs. BioMed Central 2015-12-02 /pmc/articles/PMC4668697/ /pubmed/26635958 http://dx.doi.org/10.1186/s40104-015-0049-5 Text en © Li et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Li, Hanlin
Zhao, Pinyao
Lei, Yan
Li, Tianshui
Kim, InHo
Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title_full Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title_fullStr Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title_full_unstemmed Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title_short Response to an Escherichia coli K88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
title_sort response to an escherichia coli k88 oral challenge and productivity of weanling pigs receiving a dietary nucleotides supplement
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4668697/
https://www.ncbi.nlm.nih.gov/pubmed/26635958
http://dx.doi.org/10.1186/s40104-015-0049-5
work_keys_str_mv AT lihanlin responsetoanescherichiacolik88oralchallengeandproductivityofweanlingpigsreceivingadietarynucleotidessupplement
AT zhaopinyao responsetoanescherichiacolik88oralchallengeandproductivityofweanlingpigsreceivingadietarynucleotidessupplement
AT leiyan responsetoanescherichiacolik88oralchallengeandproductivityofweanlingpigsreceivingadietarynucleotidessupplement
AT litianshui responsetoanescherichiacolik88oralchallengeandproductivityofweanlingpigsreceivingadietarynucleotidessupplement
AT kiminho responsetoanescherichiacolik88oralchallengeandproductivityofweanlingpigsreceivingadietarynucleotidessupplement