Cargando…

Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs

Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In th...

Descripción completa

Detalles Bibliográficos
Autores principales: Dai, Xiaoxin, Zhang, Mianqun, Lu, Yajuan, Miao, Yilong, Zhou, Changyin, Sun, Shaochen, Xiong, Bo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669189/
https://www.ncbi.nlm.nih.gov/pubmed/26633308
http://dx.doi.org/10.1371/journal.pone.0144248
_version_ 1782404079925854208
author Dai, Xiaoxin
Zhang, Mianqun
Lu, Yajuan
Miao, Yilong
Zhou, Changyin
Sun, Shaochen
Xiong, Bo
author_facet Dai, Xiaoxin
Zhang, Mianqun
Lu, Yajuan
Miao, Yilong
Zhou, Changyin
Sun, Shaochen
Xiong, Bo
author_sort Dai, Xiaoxin
collection PubMed
description Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In the present study, we explore the underlying mechanism regarding how melamine compromises fertility in the mouse. The data showed that melamine exposure significantly impaired the fertilization capability of the egg during in vitro fertilization. To further figure out the cause, we analyzed ovastacin localization and protein level, the sperm binding ability of zona pellucida, and ZP2 cleavage status in unfertilized eggs from melamine fed mice, and no obvious differences were found between control and treatment groups. However, the protein level of Juno on the egg plasma membrane in the high-dose feeding group indeed significantly decreased compared to the control group. Thus, these data suggest that melamine compromises female fertility via suppressing Juno protein level on the egg membrane.
format Online
Article
Text
id pubmed-4669189
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-46691892015-12-10 Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs Dai, Xiaoxin Zhang, Mianqun Lu, Yajuan Miao, Yilong Zhou, Changyin Sun, Shaochen Xiong, Bo PLoS One Research Article Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In the present study, we explore the underlying mechanism regarding how melamine compromises fertility in the mouse. The data showed that melamine exposure significantly impaired the fertilization capability of the egg during in vitro fertilization. To further figure out the cause, we analyzed ovastacin localization and protein level, the sperm binding ability of zona pellucida, and ZP2 cleavage status in unfertilized eggs from melamine fed mice, and no obvious differences were found between control and treatment groups. However, the protein level of Juno on the egg plasma membrane in the high-dose feeding group indeed significantly decreased compared to the control group. Thus, these data suggest that melamine compromises female fertility via suppressing Juno protein level on the egg membrane. Public Library of Science 2015-12-03 /pmc/articles/PMC4669189/ /pubmed/26633308 http://dx.doi.org/10.1371/journal.pone.0144248 Text en © 2015 Dai et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Dai, Xiaoxin
Zhang, Mianqun
Lu, Yajuan
Miao, Yilong
Zhou, Changyin
Sun, Shaochen
Xiong, Bo
Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title_full Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title_fullStr Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title_full_unstemmed Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title_short Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
title_sort melamine impairs female fertility via suppressing protein level of juno in mouse eggs
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669189/
https://www.ncbi.nlm.nih.gov/pubmed/26633308
http://dx.doi.org/10.1371/journal.pone.0144248
work_keys_str_mv AT daixiaoxin melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT zhangmianqun melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT luyajuan melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT miaoyilong melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT zhouchangyin melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT sunshaochen melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs
AT xiongbo melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs