Cargando…
Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs
Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In th...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669189/ https://www.ncbi.nlm.nih.gov/pubmed/26633308 http://dx.doi.org/10.1371/journal.pone.0144248 |
_version_ | 1782404079925854208 |
---|---|
author | Dai, Xiaoxin Zhang, Mianqun Lu, Yajuan Miao, Yilong Zhou, Changyin Sun, Shaochen Xiong, Bo |
author_facet | Dai, Xiaoxin Zhang, Mianqun Lu, Yajuan Miao, Yilong Zhou, Changyin Sun, Shaochen Xiong, Bo |
author_sort | Dai, Xiaoxin |
collection | PubMed |
description | Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In the present study, we explore the underlying mechanism regarding how melamine compromises fertility in the mouse. The data showed that melamine exposure significantly impaired the fertilization capability of the egg during in vitro fertilization. To further figure out the cause, we analyzed ovastacin localization and protein level, the sperm binding ability of zona pellucida, and ZP2 cleavage status in unfertilized eggs from melamine fed mice, and no obvious differences were found between control and treatment groups. However, the protein level of Juno on the egg plasma membrane in the high-dose feeding group indeed significantly decreased compared to the control group. Thus, these data suggest that melamine compromises female fertility via suppressing Juno protein level on the egg membrane. |
format | Online Article Text |
id | pubmed-4669189 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-46691892015-12-10 Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs Dai, Xiaoxin Zhang, Mianqun Lu, Yajuan Miao, Yilong Zhou, Changyin Sun, Shaochen Xiong, Bo PLoS One Research Article Melamine is an organic nitrogenous compound widely used as an industrial chemical, and it has been recently reported by us that melamine has a toxic effect on the female reproductive system in mice, and renders females subfertile; the molecular basis, however, has not been adequately assessed. In the present study, we explore the underlying mechanism regarding how melamine compromises fertility in the mouse. The data showed that melamine exposure significantly impaired the fertilization capability of the egg during in vitro fertilization. To further figure out the cause, we analyzed ovastacin localization and protein level, the sperm binding ability of zona pellucida, and ZP2 cleavage status in unfertilized eggs from melamine fed mice, and no obvious differences were found between control and treatment groups. However, the protein level of Juno on the egg plasma membrane in the high-dose feeding group indeed significantly decreased compared to the control group. Thus, these data suggest that melamine compromises female fertility via suppressing Juno protein level on the egg membrane. Public Library of Science 2015-12-03 /pmc/articles/PMC4669189/ /pubmed/26633308 http://dx.doi.org/10.1371/journal.pone.0144248 Text en © 2015 Dai et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Dai, Xiaoxin Zhang, Mianqun Lu, Yajuan Miao, Yilong Zhou, Changyin Sun, Shaochen Xiong, Bo Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title | Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title_full | Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title_fullStr | Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title_full_unstemmed | Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title_short | Melamine Impairs Female Fertility via Suppressing Protein Level of Juno in Mouse Eggs |
title_sort | melamine impairs female fertility via suppressing protein level of juno in mouse eggs |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669189/ https://www.ncbi.nlm.nih.gov/pubmed/26633308 http://dx.doi.org/10.1371/journal.pone.0144248 |
work_keys_str_mv | AT daixiaoxin melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT zhangmianqun melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT luyajuan melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT miaoyilong melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT zhouchangyin melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT sunshaochen melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs AT xiongbo melamineimpairsfemalefertilityviasuppressingproteinlevelofjunoinmouseeggs |