Cargando…
Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis
BACKGROUND: To date, diagnosis of Primary Ciliary Dyskinesia (PCD) remains difficult and challenging. We systematically evaluated the diagnostic performance of nasal Nitric Oxide (nNO) measurement for the detection of PCD, using either velum-closure (VC) or non-velum-closure (non-VC) techniques. MET...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669667/ https://www.ncbi.nlm.nih.gov/pubmed/26634346 http://dx.doi.org/10.1186/s12890-015-0147-3 |
_version_ | 1782404140506284032 |
---|---|
author | Kouis, Panayiotis Papatheodorou, Stefania I. Yiallouros, Panayiotis K. |
author_facet | Kouis, Panayiotis Papatheodorou, Stefania I. Yiallouros, Panayiotis K. |
author_sort | Kouis, Panayiotis |
collection | PubMed |
description | BACKGROUND: To date, diagnosis of Primary Ciliary Dyskinesia (PCD) remains difficult and challenging. We systematically evaluated the diagnostic performance of nasal Nitric Oxide (nNO) measurement for the detection of PCD, using either velum-closure (VC) or non-velum-closure (non-VC) techniques. METHODS: All major electronic databases were searched from inception until March 2015 using appropriate terms. The sensitivity and specificity of nNO measurement was calculated in PCD patients diagnosed by transmission electron microscopy, high speed video-microscopy or genetic testing. Summary receiver operating characteristic (HSROC) curves were drawn using the parameters of the fitted models. RESULTS: Twelve studies provided data for 13 different populations, including nine case–control (n = 793) and four prospective cohorts (n = 392). The overall sensitivity of nNO measured by VC techniques was 0.95 (95 % CI 0.91–0.97), while specificity was 0.94 (95 % CI 0.88–0.97). The positive likelihood ratio (LR+) of the test was 15.8 (95 % CI 8.1–30.6), whereas the negative likelihood ratio (LR-) was 0.06 (95 % CI 0.04–0.09). For non-VC techniques, the overall sensitivity of nNO measurement was 0.93 (95 % CI 0.89–0.96) whereas specificity was 0.95 (95 % CI 0.82–0.99). The LR+ of the test was 18.5 (95 % CI 4.6–73.8) whereas the LR- was 0.07 (95 % CI 0.04–0.12). CONCLUSIONS: Diagnostic accuracy of nNO measurement both with VC and non-VC maneuvers is high and can be effectively employed in the clinical setting to detect PCD even in young children, thus potentiating early diagnosis. Measurement of nNO merits to be part of a revised diagnostic algorithm with the most efficacious combination of tests to achieve PCD diagnosis. |
format | Online Article Text |
id | pubmed-4669667 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-46696672015-12-05 Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis Kouis, Panayiotis Papatheodorou, Stefania I. Yiallouros, Panayiotis K. BMC Pulm Med Research Article BACKGROUND: To date, diagnosis of Primary Ciliary Dyskinesia (PCD) remains difficult and challenging. We systematically evaluated the diagnostic performance of nasal Nitric Oxide (nNO) measurement for the detection of PCD, using either velum-closure (VC) or non-velum-closure (non-VC) techniques. METHODS: All major electronic databases were searched from inception until March 2015 using appropriate terms. The sensitivity and specificity of nNO measurement was calculated in PCD patients diagnosed by transmission electron microscopy, high speed video-microscopy or genetic testing. Summary receiver operating characteristic (HSROC) curves were drawn using the parameters of the fitted models. RESULTS: Twelve studies provided data for 13 different populations, including nine case–control (n = 793) and four prospective cohorts (n = 392). The overall sensitivity of nNO measured by VC techniques was 0.95 (95 % CI 0.91–0.97), while specificity was 0.94 (95 % CI 0.88–0.97). The positive likelihood ratio (LR+) of the test was 15.8 (95 % CI 8.1–30.6), whereas the negative likelihood ratio (LR-) was 0.06 (95 % CI 0.04–0.09). For non-VC techniques, the overall sensitivity of nNO measurement was 0.93 (95 % CI 0.89–0.96) whereas specificity was 0.95 (95 % CI 0.82–0.99). The LR+ of the test was 18.5 (95 % CI 4.6–73.8) whereas the LR- was 0.07 (95 % CI 0.04–0.12). CONCLUSIONS: Diagnostic accuracy of nNO measurement both with VC and non-VC maneuvers is high and can be effectively employed in the clinical setting to detect PCD even in young children, thus potentiating early diagnosis. Measurement of nNO merits to be part of a revised diagnostic algorithm with the most efficacious combination of tests to achieve PCD diagnosis. BioMed Central 2015-12-03 /pmc/articles/PMC4669667/ /pubmed/26634346 http://dx.doi.org/10.1186/s12890-015-0147-3 Text en © Kouis et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Kouis, Panayiotis Papatheodorou, Stefania I. Yiallouros, Panayiotis K. Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title | Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title_full | Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title_fullStr | Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title_full_unstemmed | Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title_short | Diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
title_sort | diagnostic accuracy of nasal nitric oxide for establishing diagnosis of primary ciliary dyskinesia: a meta-analysis |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4669667/ https://www.ncbi.nlm.nih.gov/pubmed/26634346 http://dx.doi.org/10.1186/s12890-015-0147-3 |
work_keys_str_mv | AT kouispanayiotis diagnosticaccuracyofnasalnitricoxideforestablishingdiagnosisofprimaryciliarydyskinesiaametaanalysis AT papatheodoroustefaniai diagnosticaccuracyofnasalnitricoxideforestablishingdiagnosisofprimaryciliarydyskinesiaametaanalysis AT yiallourospanayiotisk diagnosticaccuracyofnasalnitricoxideforestablishingdiagnosisofprimaryciliarydyskinesiaametaanalysis |