Cargando…
The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review
BACKGROUND: Laboratory testing is an integral part of day-to-day primary care practice, with approximately 30 % of patient encounters resulting in a request. However, research suggests that a large proportion of requests does not benefit patient care and is avoidable. The aim of this systematic revi...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4670500/ https://www.ncbi.nlm.nih.gov/pubmed/26637335 http://dx.doi.org/10.1186/s13012-015-0356-4 |
_version_ | 1782404266181263360 |
---|---|
author | Cadogan, Sharon L. Browne, John P. Bradley, Colin P. Cahill, Mary R. |
author_facet | Cadogan, Sharon L. Browne, John P. Bradley, Colin P. Cahill, Mary R. |
author_sort | Cadogan, Sharon L. |
collection | PubMed |
description | BACKGROUND: Laboratory testing is an integral part of day-to-day primary care practice, with approximately 30 % of patient encounters resulting in a request. However, research suggests that a large proportion of requests does not benefit patient care and is avoidable. The aim of this systematic review was to comprehensively search the literature for studies evaluating the effectiveness of interventions to improve primary care physician use of laboratory tests. METHODS: A search of PubMed, Cochrane Library, Embase and Scopus (from inception to 09/02/14) was conducted. The following study designs were considered: systematic reviews, randomised controlled trials (RCTs), controlled clinical trials (CCTs), controlled before and after studies (CBAs) and interrupted time series analysis (ITSs). Studies were quality appraised using a modified version of the Effective Practice and Organisation of Care (EPOC) checklist. The population of interest was primary care physicians. Interventions were considered if they aimed to improve laboratory testing in primary care. The outcome of interest was a volume of laboratory tests. RESULTS: In total, 6,166 titles and abstracts were reviewed, followed by 87 full texts. Of these, 11 papers were eligible for inclusion in the systematic review. This included four RCTs, six CBAs and one ITS study. The types of interventions examined included education, feedback, guidelines, education with feedback, feedback with guidelines and changing order forms. The quality of included studies varied with seven studies deemed to have a low risk of bias, three with unclear risk of bias and one with high risk of bias. All but one study found significant reductions in the volume of tests following the intervention, with effect sizes ranging from 1.2 to 60 %. Due to heterogeneity, meta-analysis was not performed. CONCLUSIONS: Interventions such as educational strategies, feedback and changing test order forms may improve the efficient use of laboratory tests in primary care; however, the level of evidence is quite low and the quality is poor. The reproducibility of findings from different laboratories is also difficult to ascertain from the literature. Some standardisation of both interventions and outcome measures is required to enable formal meta-analysis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13012-015-0356-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4670500 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-46705002015-12-06 The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review Cadogan, Sharon L. Browne, John P. Bradley, Colin P. Cahill, Mary R. Implement Sci Systematic Review BACKGROUND: Laboratory testing is an integral part of day-to-day primary care practice, with approximately 30 % of patient encounters resulting in a request. However, research suggests that a large proportion of requests does not benefit patient care and is avoidable. The aim of this systematic review was to comprehensively search the literature for studies evaluating the effectiveness of interventions to improve primary care physician use of laboratory tests. METHODS: A search of PubMed, Cochrane Library, Embase and Scopus (from inception to 09/02/14) was conducted. The following study designs were considered: systematic reviews, randomised controlled trials (RCTs), controlled clinical trials (CCTs), controlled before and after studies (CBAs) and interrupted time series analysis (ITSs). Studies were quality appraised using a modified version of the Effective Practice and Organisation of Care (EPOC) checklist. The population of interest was primary care physicians. Interventions were considered if they aimed to improve laboratory testing in primary care. The outcome of interest was a volume of laboratory tests. RESULTS: In total, 6,166 titles and abstracts were reviewed, followed by 87 full texts. Of these, 11 papers were eligible for inclusion in the systematic review. This included four RCTs, six CBAs and one ITS study. The types of interventions examined included education, feedback, guidelines, education with feedback, feedback with guidelines and changing order forms. The quality of included studies varied with seven studies deemed to have a low risk of bias, three with unclear risk of bias and one with high risk of bias. All but one study found significant reductions in the volume of tests following the intervention, with effect sizes ranging from 1.2 to 60 %. Due to heterogeneity, meta-analysis was not performed. CONCLUSIONS: Interventions such as educational strategies, feedback and changing test order forms may improve the efficient use of laboratory tests in primary care; however, the level of evidence is quite low and the quality is poor. The reproducibility of findings from different laboratories is also difficult to ascertain from the literature. Some standardisation of both interventions and outcome measures is required to enable formal meta-analysis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13012-015-0356-4) contains supplementary material, which is available to authorized users. BioMed Central 2015-12-05 /pmc/articles/PMC4670500/ /pubmed/26637335 http://dx.doi.org/10.1186/s13012-015-0356-4 Text en © Cadogan et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Systematic Review Cadogan, Sharon L. Browne, John P. Bradley, Colin P. Cahill, Mary R. The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title | The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title_full | The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title_fullStr | The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title_full_unstemmed | The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title_short | The effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
title_sort | effectiveness of interventions to improve laboratory requesting patterns among primary care physicians: a systematic review |
topic | Systematic Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4670500/ https://www.ncbi.nlm.nih.gov/pubmed/26637335 http://dx.doi.org/10.1186/s13012-015-0356-4 |
work_keys_str_mv | AT cadogansharonl theeffectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT brownejohnp theeffectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT bradleycolinp theeffectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT cahillmaryr theeffectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT cadogansharonl effectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT brownejohnp effectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT bradleycolinp effectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview AT cahillmaryr effectivenessofinterventionstoimprovelaboratoryrequestingpatternsamongprimarycarephysiciansasystematicreview |