Cargando…

Synapsin Isoforms and Synaptic Vesicle Trafficking

Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic ves...

Descripción completa

Detalles Bibliográficos
Autores principales: Song, Sang-Ho, Augustine, George J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Korean Society for Molecular and Cellular Biology 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4673407/
https://www.ncbi.nlm.nih.gov/pubmed/26627875
http://dx.doi.org/10.14348/molcells.2015.0233
_version_ 1782404732154806272
author Song, Sang-Ho
Augustine, George J.
author_facet Song, Sang-Ho
Augustine, George J.
author_sort Song, Sang-Ho
collection PubMed
description Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic vesicles. The structural underpinnings for these functions are just beginning to be understood and should provide a focus for future efforts.
format Online
Article
Text
id pubmed-4673407
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Korean Society for Molecular and Cellular Biology
record_format MEDLINE/PubMed
spelling pubmed-46734072015-12-11 Synapsin Isoforms and Synaptic Vesicle Trafficking Song, Sang-Ho Augustine, George J. Mol Cells Minireview Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic vesicles. The structural underpinnings for these functions are just beginning to be understood and should provide a focus for future efforts. Korean Society for Molecular and Cellular Biology 2015-11-30 2015-11-20 /pmc/articles/PMC4673407/ /pubmed/26627875 http://dx.doi.org/10.14348/molcells.2015.0233 Text en © The Korean Society for Molecular and Cellular Biology. All rights reserved. This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-sa/3.0/.
spellingShingle Minireview
Song, Sang-Ho
Augustine, George J.
Synapsin Isoforms and Synaptic Vesicle Trafficking
title Synapsin Isoforms and Synaptic Vesicle Trafficking
title_full Synapsin Isoforms and Synaptic Vesicle Trafficking
title_fullStr Synapsin Isoforms and Synaptic Vesicle Trafficking
title_full_unstemmed Synapsin Isoforms and Synaptic Vesicle Trafficking
title_short Synapsin Isoforms and Synaptic Vesicle Trafficking
title_sort synapsin isoforms and synaptic vesicle trafficking
topic Minireview
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4673407/
https://www.ncbi.nlm.nih.gov/pubmed/26627875
http://dx.doi.org/10.14348/molcells.2015.0233
work_keys_str_mv AT songsangho synapsinisoformsandsynapticvesicletrafficking
AT augustinegeorgej synapsinisoformsandsynapticvesicletrafficking