Cargando…
Synapsin Isoforms and Synaptic Vesicle Trafficking
Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic ves...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Korean Society for Molecular and Cellular Biology
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4673407/ https://www.ncbi.nlm.nih.gov/pubmed/26627875 http://dx.doi.org/10.14348/molcells.2015.0233 |
_version_ | 1782404732154806272 |
---|---|
author | Song, Sang-Ho Augustine, George J. |
author_facet | Song, Sang-Ho Augustine, George J. |
author_sort | Song, Sang-Ho |
collection | PubMed |
description | Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic vesicles. The structural underpinnings for these functions are just beginning to be understood and should provide a focus for future efforts. |
format | Online Article Text |
id | pubmed-4673407 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Korean Society for Molecular and Cellular Biology |
record_format | MEDLINE/PubMed |
spelling | pubmed-46734072015-12-11 Synapsin Isoforms and Synaptic Vesicle Trafficking Song, Sang-Ho Augustine, George J. Mol Cells Minireview Synapsins were the first presynaptic proteins identified and have served as the flagship of the presynaptic protein field. Here we review recent studies demonstrating that different members of the synapsin family play different roles at presynaptic terminals employing different types of synaptic vesicles. The structural underpinnings for these functions are just beginning to be understood and should provide a focus for future efforts. Korean Society for Molecular and Cellular Biology 2015-11-30 2015-11-20 /pmc/articles/PMC4673407/ /pubmed/26627875 http://dx.doi.org/10.14348/molcells.2015.0233 Text en © The Korean Society for Molecular and Cellular Biology. All rights reserved. This is an open-access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License. To view a copy of this license, visit http://creativecommons.org/licenses/by-nc-sa/3.0/. |
spellingShingle | Minireview Song, Sang-Ho Augustine, George J. Synapsin Isoforms and Synaptic Vesicle Trafficking |
title | Synapsin Isoforms and Synaptic Vesicle Trafficking |
title_full | Synapsin Isoforms and Synaptic Vesicle Trafficking |
title_fullStr | Synapsin Isoforms and Synaptic Vesicle Trafficking |
title_full_unstemmed | Synapsin Isoforms and Synaptic Vesicle Trafficking |
title_short | Synapsin Isoforms and Synaptic Vesicle Trafficking |
title_sort | synapsin isoforms and synaptic vesicle trafficking |
topic | Minireview |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4673407/ https://www.ncbi.nlm.nih.gov/pubmed/26627875 http://dx.doi.org/10.14348/molcells.2015.0233 |
work_keys_str_mv | AT songsangho synapsinisoformsandsynapticvesicletrafficking AT augustinegeorgej synapsinisoformsandsynapticvesicletrafficking |