Cargando…
Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium
The leaves of Perilla frutescens (L.) Britt. have been traditionally used as an herbal medicine in East Asian countries to treat a variety diseases. In this present study, we investigated the inhibitory effects of P. frutescens extract (PFE) on N-formyl-Met-Leu-Phe (fMLF)-stimulated human neutrophil...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4677386/ https://www.ncbi.nlm.nih.gov/pubmed/26659126 http://dx.doi.org/10.1038/srep18204 |
_version_ | 1782405323439472640 |
---|---|
author | Chen, Chun-Yu Leu, Yann-Lii Fang, Yu Lin, Chwan-Fwu Kuo, Liang-Mou Sung, Wei-Che Tsai, Yung-Fong Chung, Pei-Jen Lee, Ming-Chung Kuo, Yu-Ting Yang, Hsuan-Wu Hwang, Tsong-Long |
author_facet | Chen, Chun-Yu Leu, Yann-Lii Fang, Yu Lin, Chwan-Fwu Kuo, Liang-Mou Sung, Wei-Che Tsai, Yung-Fong Chung, Pei-Jen Lee, Ming-Chung Kuo, Yu-Ting Yang, Hsuan-Wu Hwang, Tsong-Long |
author_sort | Chen, Chun-Yu |
collection | PubMed |
description | The leaves of Perilla frutescens (L.) Britt. have been traditionally used as an herbal medicine in East Asian countries to treat a variety diseases. In this present study, we investigated the inhibitory effects of P. frutescens extract (PFE) on N-formyl-Met-Leu-Phe (fMLF)-stimulated human neutrophils and the underlying mechanisms. PFE (1, 3, and 10 μg/ml) inhibited superoxide anion production, elastase release, reactive oxygen species formation, CD11b expression, and cell migration in fMLF-activated human neutrophils in dose-dependent manners. PFE inhibited fMLF-induced phosphorylation of the Src family kinases (SFKs), Src (Tyr416) and Lyn (Tyr396), and reduced their enzymatic activities. Both PFE and PP2 (a selective inhibitor of SFKs) reduced the phosphorylation of Burton’s tyrosine kinases (Tyr223) and Vav (Tyr174) in fMLF-activated human neutrophils. Additionally, PFE decreased intracellular Ca(2+) levels ([Ca(2+)](i)), whereas PP2 prolonged the time required for [Ca(2+)](i) to return to its basal level. Our findings indicated that PFE effectively regulated the inflammatory activities of fMLF-activated human neutrophils. The anti-inflammatory effects of PFE on activated human neutrophils were mediated through two independent signaling pathways involving SFKs (Src and Lyn) and mobilization of intracellular Ca(2+). |
format | Online Article Text |
id | pubmed-4677386 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-46773862015-12-17 Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium Chen, Chun-Yu Leu, Yann-Lii Fang, Yu Lin, Chwan-Fwu Kuo, Liang-Mou Sung, Wei-Che Tsai, Yung-Fong Chung, Pei-Jen Lee, Ming-Chung Kuo, Yu-Ting Yang, Hsuan-Wu Hwang, Tsong-Long Sci Rep Article The leaves of Perilla frutescens (L.) Britt. have been traditionally used as an herbal medicine in East Asian countries to treat a variety diseases. In this present study, we investigated the inhibitory effects of P. frutescens extract (PFE) on N-formyl-Met-Leu-Phe (fMLF)-stimulated human neutrophils and the underlying mechanisms. PFE (1, 3, and 10 μg/ml) inhibited superoxide anion production, elastase release, reactive oxygen species formation, CD11b expression, and cell migration in fMLF-activated human neutrophils in dose-dependent manners. PFE inhibited fMLF-induced phosphorylation of the Src family kinases (SFKs), Src (Tyr416) and Lyn (Tyr396), and reduced their enzymatic activities. Both PFE and PP2 (a selective inhibitor of SFKs) reduced the phosphorylation of Burton’s tyrosine kinases (Tyr223) and Vav (Tyr174) in fMLF-activated human neutrophils. Additionally, PFE decreased intracellular Ca(2+) levels ([Ca(2+)](i)), whereas PP2 prolonged the time required for [Ca(2+)](i) to return to its basal level. Our findings indicated that PFE effectively regulated the inflammatory activities of fMLF-activated human neutrophils. The anti-inflammatory effects of PFE on activated human neutrophils were mediated through two independent signaling pathways involving SFKs (Src and Lyn) and mobilization of intracellular Ca(2+). Nature Publishing Group 2015-12-14 /pmc/articles/PMC4677386/ /pubmed/26659126 http://dx.doi.org/10.1038/srep18204 Text en Copyright © 2015, Macmillan Publishers Limited http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Chen, Chun-Yu Leu, Yann-Lii Fang, Yu Lin, Chwan-Fwu Kuo, Liang-Mou Sung, Wei-Che Tsai, Yung-Fong Chung, Pei-Jen Lee, Ming-Chung Kuo, Yu-Ting Yang, Hsuan-Wu Hwang, Tsong-Long Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title | Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title_full | Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title_fullStr | Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title_full_unstemmed | Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title_short | Anti-inflammatory effects of Perilla frutescens in activated human neutrophils through two independent pathways: Src family kinases and Calcium |
title_sort | anti-inflammatory effects of perilla frutescens in activated human neutrophils through two independent pathways: src family kinases and calcium |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4677386/ https://www.ncbi.nlm.nih.gov/pubmed/26659126 http://dx.doi.org/10.1038/srep18204 |
work_keys_str_mv | AT chenchunyu antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT leuyannlii antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT fangyu antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT linchwanfwu antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT kuoliangmou antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT sungweiche antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT tsaiyungfong antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT chungpeijen antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT leemingchung antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT kuoyuting antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT yanghsuanwu antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium AT hwangtsonglong antiinflammatoryeffectsofperillafrutescensinactivatedhumanneutrophilsthroughtwoindependentpathwayssrcfamilykinasesandcalcium |