Cargando…

Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency

Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic...

Descripción completa

Detalles Bibliográficos
Autores principales: Komarow, Hirsh D., Sokolic, Robert, Hershfield, Michael S., Kohn, Donald B., Young, Michael, Metcalfe, Dean D., Candotti, Fabio
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4683718/
https://www.ncbi.nlm.nih.gov/pubmed/26682746
http://dx.doi.org/10.1186/s13023-015-0365-z
_version_ 1782406070773219328
author Komarow, Hirsh D.
Sokolic, Robert
Hershfield, Michael S.
Kohn, Donald B.
Young, Michael
Metcalfe, Dean D.
Candotti, Fabio
author_facet Komarow, Hirsh D.
Sokolic, Robert
Hershfield, Michael S.
Kohn, Donald B.
Young, Michael
Metcalfe, Dean D.
Candotti, Fabio
author_sort Komarow, Hirsh D.
collection PubMed
description Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic adenosine levels. Lung disease assessment has primarily employed repetitive radiography and effort-dependent functional studies. Through impulse oscillometry (IOS), which is effort-independent, we prospectively obtained objective measures of lung dysfunction in 10 children with ADA-SCID. These results support the use of IOS in the identification and monitoring of lung function abnormalities in children with primary immunodeficiencies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-015-0365-z) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4683718
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-46837182015-12-19 Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency Komarow, Hirsh D. Sokolic, Robert Hershfield, Michael S. Kohn, Donald B. Young, Michael Metcalfe, Dean D. Candotti, Fabio Orphanet J Rare Dis Letter to the Editor Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic adenosine levels. Lung disease assessment has primarily employed repetitive radiography and effort-dependent functional studies. Through impulse oscillometry (IOS), which is effort-independent, we prospectively obtained objective measures of lung dysfunction in 10 children with ADA-SCID. These results support the use of IOS in the identification and monitoring of lung function abnormalities in children with primary immunodeficiencies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-015-0365-z) contains supplementary material, which is available to authorized users. BioMed Central 2015-12-18 /pmc/articles/PMC4683718/ /pubmed/26682746 http://dx.doi.org/10.1186/s13023-015-0365-z Text en © Komarow et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Letter to the Editor
Komarow, Hirsh D.
Sokolic, Robert
Hershfield, Michael S.
Kohn, Donald B.
Young, Michael
Metcalfe, Dean D.
Candotti, Fabio
Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title_full Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title_fullStr Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title_full_unstemmed Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title_short Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
title_sort impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
topic Letter to the Editor
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4683718/
https://www.ncbi.nlm.nih.gov/pubmed/26682746
http://dx.doi.org/10.1186/s13023-015-0365-z
work_keys_str_mv AT komarowhirshd impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT sokolicrobert impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT hershfieldmichaels impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT kohndonaldb impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT youngmichael impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT metcalfedeand impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency
AT candottifabio impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency