Cargando…
Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency
Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4683718/ https://www.ncbi.nlm.nih.gov/pubmed/26682746 http://dx.doi.org/10.1186/s13023-015-0365-z |
_version_ | 1782406070773219328 |
---|---|
author | Komarow, Hirsh D. Sokolic, Robert Hershfield, Michael S. Kohn, Donald B. Young, Michael Metcalfe, Dean D. Candotti, Fabio |
author_facet | Komarow, Hirsh D. Sokolic, Robert Hershfield, Michael S. Kohn, Donald B. Young, Michael Metcalfe, Dean D. Candotti, Fabio |
author_sort | Komarow, Hirsh D. |
collection | PubMed |
description | Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic adenosine levels. Lung disease assessment has primarily employed repetitive radiography and effort-dependent functional studies. Through impulse oscillometry (IOS), which is effort-independent, we prospectively obtained objective measures of lung dysfunction in 10 children with ADA-SCID. These results support the use of IOS in the identification and monitoring of lung function abnormalities in children with primary immunodeficiencies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-015-0365-z) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4683718 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-46837182015-12-19 Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency Komarow, Hirsh D. Sokolic, Robert Hershfield, Michael S. Kohn, Donald B. Young, Michael Metcalfe, Dean D. Candotti, Fabio Orphanet J Rare Dis Letter to the Editor Adenosine deaminase-deficient severe combined immunodeficiency (ADA-SCID) is characterized by impaired T-, B- and NK-cell function. Affected children, in addition to early onset of infections, manifest non-immunologic symptoms including pulmonary dysfunction likely attributable to elevated systemic adenosine levels. Lung disease assessment has primarily employed repetitive radiography and effort-dependent functional studies. Through impulse oscillometry (IOS), which is effort-independent, we prospectively obtained objective measures of lung dysfunction in 10 children with ADA-SCID. These results support the use of IOS in the identification and monitoring of lung function abnormalities in children with primary immunodeficiencies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-015-0365-z) contains supplementary material, which is available to authorized users. BioMed Central 2015-12-18 /pmc/articles/PMC4683718/ /pubmed/26682746 http://dx.doi.org/10.1186/s13023-015-0365-z Text en © Komarow et al. 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Letter to the Editor Komarow, Hirsh D. Sokolic, Robert Hershfield, Michael S. Kohn, Donald B. Young, Michael Metcalfe, Dean D. Candotti, Fabio Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title | Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title_full | Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title_fullStr | Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title_full_unstemmed | Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title_short | Impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
title_sort | impulse oscillometry identifies peripheral airway dysfunction in children with adenosine deaminase deficiency |
topic | Letter to the Editor |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4683718/ https://www.ncbi.nlm.nih.gov/pubmed/26682746 http://dx.doi.org/10.1186/s13023-015-0365-z |
work_keys_str_mv | AT komarowhirshd impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT sokolicrobert impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT hershfieldmichaels impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT kohndonaldb impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT youngmichael impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT metcalfedeand impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency AT candottifabio impulseoscillometryidentifiesperipheralairwaydysfunctioninchildrenwithadenosinedeaminasedeficiency |