Cargando…

Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain

Calcium ions are considered ubiquitous second messengers in eukaryotic signal transduction pathways. Intracellular Ca(2+) concentration are modulated by various signals such as hormones and biotic and abiotic stresses. Modulation of Ca(2+) ion leads to stimulation of calcium dependent protein kinase...

Descripción completa

Detalles Bibliográficos
Autores principales: Mohanta, Tapan K., Mohanta, Nibedita, Mohanta, Yugal K., Bae, Hanhong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4690006/
https://www.ncbi.nlm.nih.gov/pubmed/26734045
http://dx.doi.org/10.3389/fpls.2015.01146
_version_ 1782406933518483456
author Mohanta, Tapan K.
Mohanta, Nibedita
Mohanta, Yugal K.
Bae, Hanhong
author_facet Mohanta, Tapan K.
Mohanta, Nibedita
Mohanta, Yugal K.
Bae, Hanhong
author_sort Mohanta, Tapan K.
collection PubMed
description Calcium ions are considered ubiquitous second messengers in eukaryotic signal transduction pathways. Intracellular Ca(2+) concentration are modulated by various signals such as hormones and biotic and abiotic stresses. Modulation of Ca(2+) ion leads to stimulation of calcium dependent protein kinase genes (CPKs), which results in regulation of gene expression and therefore mediates plant growth and development as well as biotic and abiotic stresses. Here, we reported the CPK gene family of 40 different plant species (950 CPK genes) and provided a unified nomenclature system for all of them. In addition, we analyzed their genomic, biochemical and structural conserved features. Multiple sequence alignment revealed that the kinase domain, auto-inhibitory domain and EF-hands regions of regulatory domains are highly conserved in nature. Additionally, the EF-hand domains of higher plants were found to contain four D-x-D and two D-E-L motifs, while lower eukaryotic plants had two D-x-D and one D-x-E motifs in their EF-hands. Phylogenetic analysis showed that CPK genes are clustered into four different groups. By studying the CPK gene family across the plant lineage, we provide the first evidence of the presence of D-x-D motif in the calcium binding EF-hand domain of CPK proteins.
format Online
Article
Text
id pubmed-4690006
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-46900062016-01-05 Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain Mohanta, Tapan K. Mohanta, Nibedita Mohanta, Yugal K. Bae, Hanhong Front Plant Sci Plant Science Calcium ions are considered ubiquitous second messengers in eukaryotic signal transduction pathways. Intracellular Ca(2+) concentration are modulated by various signals such as hormones and biotic and abiotic stresses. Modulation of Ca(2+) ion leads to stimulation of calcium dependent protein kinase genes (CPKs), which results in regulation of gene expression and therefore mediates plant growth and development as well as biotic and abiotic stresses. Here, we reported the CPK gene family of 40 different plant species (950 CPK genes) and provided a unified nomenclature system for all of them. In addition, we analyzed their genomic, biochemical and structural conserved features. Multiple sequence alignment revealed that the kinase domain, auto-inhibitory domain and EF-hands regions of regulatory domains are highly conserved in nature. Additionally, the EF-hand domains of higher plants were found to contain four D-x-D and two D-E-L motifs, while lower eukaryotic plants had two D-x-D and one D-x-E motifs in their EF-hands. Phylogenetic analysis showed that CPK genes are clustered into four different groups. By studying the CPK gene family across the plant lineage, we provide the first evidence of the presence of D-x-D motif in the calcium binding EF-hand domain of CPK proteins. Frontiers Media S.A. 2015-12-24 /pmc/articles/PMC4690006/ /pubmed/26734045 http://dx.doi.org/10.3389/fpls.2015.01146 Text en Copyright © 2015 Mohanta, Mohanta, Mohanta and Bae. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Plant Science
Mohanta, Tapan K.
Mohanta, Nibedita
Mohanta, Yugal K.
Bae, Hanhong
Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title_full Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title_fullStr Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title_full_unstemmed Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title_short Genome-Wide Identification of Calcium Dependent Protein Kinase Gene Family in Plant Lineage Shows Presence of Novel D-x-D and D-E-L Motifs in EF-Hand Domain
title_sort genome-wide identification of calcium dependent protein kinase gene family in plant lineage shows presence of novel d-x-d and d-e-l motifs in ef-hand domain
topic Plant Science
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4690006/
https://www.ncbi.nlm.nih.gov/pubmed/26734045
http://dx.doi.org/10.3389/fpls.2015.01146
work_keys_str_mv AT mohantatapank genomewideidentificationofcalciumdependentproteinkinasegenefamilyinplantlineageshowspresenceofnoveldxdanddelmotifsinefhanddomain
AT mohantanibedita genomewideidentificationofcalciumdependentproteinkinasegenefamilyinplantlineageshowspresenceofnoveldxdanddelmotifsinefhanddomain
AT mohantayugalk genomewideidentificationofcalciumdependentproteinkinasegenefamilyinplantlineageshowspresenceofnoveldxdanddelmotifsinefhanddomain
AT baehanhong genomewideidentificationofcalciumdependentproteinkinasegenefamilyinplantlineageshowspresenceofnoveldxdanddelmotifsinefhanddomain