What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity

Detalles Bibliográficos
Autores principales: Klein, Michael, Cangelosi, Angelo, Wennekers, Thomas
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2015
Materias:
Poster Presentation
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4699114/
http://dx.doi.org/10.1186/1471-2202-16-S1-P283
_version_ 1782408140710477824
author Klein, Michael
Cangelosi, Angelo
Wennekers, Thomas
author_facet Klein, Michael
Cangelosi, Angelo
Wennekers, Thomas
author_sort Klein, Michael
collection PubMed
description
format Online
Article
Text
id pubmed-4699114
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-46991142016-01-13 What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity Klein, Michael Cangelosi, Angelo Wennekers, Thomas BMC Neurosci Poster Presentation BioMed Central 2015-12-18 /pmc/articles/PMC4699114/ http://dx.doi.org/10.1186/1471-2202-16-S1-P283 Text en Copyright © 2015 Klein et al. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Poster Presentation
Klein, Michael
Cangelosi, Angelo
Wennekers, Thomas
What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title_full What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title_fullStr What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title_full_unstemmed What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title_short What must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
title_sort what must come down goes up - the effect of noise on weights in spike-timing-dependent plasticity
topic Poster Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4699114/
http://dx.doi.org/10.1186/1471-2202-16-S1-P283
work_keys_str_mv AT kleinmichael whatmustcomedowngoesuptheeffectofnoiseonweightsinspiketimingdependentplasticity
AT cangelosiangelo whatmustcomedowngoesuptheeffectofnoiseonweightsinspiketimingdependentplasticity
AT wennekersthomas whatmustcomedowngoesuptheeffectofnoiseonweightsinspiketimingdependentplasticity

Ejemplares similares