Cargando…
Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties
BACKGROUND: Task shifting from higher cadre providers to CHWs has been widely adopted to address healthcare provider shortages, but the addition of any service can potentially add to an already considerable workload for CHWs. Objective measures of workload alone, such as work-related time and travel...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4702334/ https://www.ncbi.nlm.nih.gov/pubmed/26732671 http://dx.doi.org/10.1186/s12978-015-0110-z |
_version_ | 1782408620864962560 |
---|---|
author | Chin-Quee, Dawn Mugeni, Cathy Nkunda, Denis Uwizeye, Marie Rose Stockton, Laurie L. Wesson, Jennifer |
author_facet | Chin-Quee, Dawn Mugeni, Cathy Nkunda, Denis Uwizeye, Marie Rose Stockton, Laurie L. Wesson, Jennifer |
author_sort | Chin-Quee, Dawn |
collection | PubMed |
description | BACKGROUND: Task shifting from higher cadre providers to CHWs has been widely adopted to address healthcare provider shortages, but the addition of any service can potentially add to an already considerable workload for CHWs. Objective measures of workload alone, such as work-related time and travel may not reflect howCHWs actually perceive and react to their circumstances. This study combined perception and objectivemeasures of workload to examine their effect on quality of services, worker performance, and job and clientsatisfaction. METHODS: Three hundred eighty-three CHWs from control and intervention districts, where the intervention group was trained to provide contraceptive resupply, completed diaries of work-related activities for one month. Interviews were also conducted with a subset of CHWs and their clients. RESULTS: CHW diaries did not reveal significant differences between intervention and control groups in time spent on service provision or travel. Over 90 % of CHWs reported workload manageability, job satisfaction, and motivation to perform their jobs. Clients were highly satisfied with CHW services and most stated preference for future services from CHWs. CONCLUSION: The study demonstrated that adding resupply of hormonal contraceptives to CHWs’ tasks would not place undue burden on them. Accordingly, the initiative was scaled up in all 30 districts in the country. |
format | Online Article Text |
id | pubmed-4702334 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47023342016-01-07 Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties Chin-Quee, Dawn Mugeni, Cathy Nkunda, Denis Uwizeye, Marie Rose Stockton, Laurie L. Wesson, Jennifer Reprod Health Research BACKGROUND: Task shifting from higher cadre providers to CHWs has been widely adopted to address healthcare provider shortages, but the addition of any service can potentially add to an already considerable workload for CHWs. Objective measures of workload alone, such as work-related time and travel may not reflect howCHWs actually perceive and react to their circumstances. This study combined perception and objectivemeasures of workload to examine their effect on quality of services, worker performance, and job and clientsatisfaction. METHODS: Three hundred eighty-three CHWs from control and intervention districts, where the intervention group was trained to provide contraceptive resupply, completed diaries of work-related activities for one month. Interviews were also conducted with a subset of CHWs and their clients. RESULTS: CHW diaries did not reveal significant differences between intervention and control groups in time spent on service provision or travel. Over 90 % of CHWs reported workload manageability, job satisfaction, and motivation to perform their jobs. Clients were highly satisfied with CHW services and most stated preference for future services from CHWs. CONCLUSION: The study demonstrated that adding resupply of hormonal contraceptives to CHWs’ tasks would not place undue burden on them. Accordingly, the initiative was scaled up in all 30 districts in the country. BioMed Central 2016-01-06 /pmc/articles/PMC4702334/ /pubmed/26732671 http://dx.doi.org/10.1186/s12978-015-0110-z Text en © Chin-Quee et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Chin-Quee, Dawn Mugeni, Cathy Nkunda, Denis Uwizeye, Marie Rose Stockton, Laurie L. Wesson, Jennifer Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title | Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title_full | Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title_fullStr | Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title_full_unstemmed | Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title_short | Balancing workload, motivation and job satisfaction in Rwanda: assessing the effect of adding family planning service provision to community health worker duties |
title_sort | balancing workload, motivation and job satisfaction in rwanda: assessing the effect of adding family planning service provision to community health worker duties |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4702334/ https://www.ncbi.nlm.nih.gov/pubmed/26732671 http://dx.doi.org/10.1186/s12978-015-0110-z |
work_keys_str_mv | AT chinqueedawn balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties AT mugenicathy balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties AT nkundadenis balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties AT uwizeyemarierose balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties AT stocktonlauriel balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties AT wessonjennifer balancingworkloadmotivationandjobsatisfactioninrwandaassessingtheeffectofaddingfamilyplanningserviceprovisiontocommunityhealthworkerduties |