Cargando…

Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress

A study was performed to investigate the genomic variations in the shrimp farm isolates of Vibrio alginolyticus and V. harveyi when the isolates were subjected to environmental stress. Samples of shrimps, water and sediment were collected from Southern Indian coastal shrimp farms. Vibrio isolates we...

Descripción completa

Detalles Bibliográficos
Autores principales: Santhyia, Anix Vivek, Mulloorpeedikayil, Rosalind George, Kollanoor, Riji John, Jeyaseelan, Prince M.J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Sociedade Brasileira de Microbiologia 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4704611/
https://www.ncbi.nlm.nih.gov/pubmed/26691457
http://dx.doi.org/10.1590/S1517-838246420140410
_version_ 1782408887416127488
author Santhyia, Anix Vivek
Mulloorpeedikayil, Rosalind George
Kollanoor, Riji John
Jeyaseelan, Prince M.J.
author_facet Santhyia, Anix Vivek
Mulloorpeedikayil, Rosalind George
Kollanoor, Riji John
Jeyaseelan, Prince M.J.
author_sort Santhyia, Anix Vivek
collection PubMed
description A study was performed to investigate the genomic variations in the shrimp farm isolates of Vibrio alginolyticus and V. harveyi when the isolates were subjected to environmental stress. Samples of shrimps, water and sediment were collected from Southern Indian coastal shrimp farms. Vibrio isolates were biochemically identified and confirmed using 16S rDNA and gyrB gene specific PCR. The bacterial strains were genotyped by PCR fingerprinting using GTG(5) and IS (Insertion Sequence) primers. Seven strains each of V. alginolyticus and V. harveyi were subjected to 10 passages through trypticase soya broth (TSB), which contained different NaCl concentrations (3, 6 and 8%) and trypticase soya agar (TSA). V. alginolyticus was also passaged through TSB with a 12% NaCl concentration. PCR fingerprinting, which was performed on the strains that were passaged through different salt concentrations, confirmed that V. alginolyticus and V. harveyi could affect the genomic variations, depending on the environmental conditions of the culture. The study highlights the complex genotypic variations that occur in Vibrio strains of tropical aquatic environment because of varied environmental conditions, which result in genetic divergence and/or probable convergence. Such genetic divergence and/or convergence can lead to the organismal adaptive variation, which results in their ability to cause a productive infection in aquatic organisms or generation of new strains.
format Online
Article
Text
id pubmed-4704611
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Sociedade Brasileira de Microbiologia
record_format MEDLINE/PubMed
spelling pubmed-47046112016-01-14 Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress Santhyia, Anix Vivek Mulloorpeedikayil, Rosalind George Kollanoor, Riji John Jeyaseelan, Prince M.J. Braz J Microbiol Environmental Microbiology A study was performed to investigate the genomic variations in the shrimp farm isolates of Vibrio alginolyticus and V. harveyi when the isolates were subjected to environmental stress. Samples of shrimps, water and sediment were collected from Southern Indian coastal shrimp farms. Vibrio isolates were biochemically identified and confirmed using 16S rDNA and gyrB gene specific PCR. The bacterial strains were genotyped by PCR fingerprinting using GTG(5) and IS (Insertion Sequence) primers. Seven strains each of V. alginolyticus and V. harveyi were subjected to 10 passages through trypticase soya broth (TSB), which contained different NaCl concentrations (3, 6 and 8%) and trypticase soya agar (TSA). V. alginolyticus was also passaged through TSB with a 12% NaCl concentration. PCR fingerprinting, which was performed on the strains that were passaged through different salt concentrations, confirmed that V. alginolyticus and V. harveyi could affect the genomic variations, depending on the environmental conditions of the culture. The study highlights the complex genotypic variations that occur in Vibrio strains of tropical aquatic environment because of varied environmental conditions, which result in genetic divergence and/or probable convergence. Such genetic divergence and/or convergence can lead to the organismal adaptive variation, which results in their ability to cause a productive infection in aquatic organisms or generation of new strains. Sociedade Brasileira de Microbiologia 2015-12-01 /pmc/articles/PMC4704611/ /pubmed/26691457 http://dx.doi.org/10.1590/S1517-838246420140410 Text en Copyright © 2015, Sociedade Brasileira de Microbiologia http://creativecommons.org/licenses/by-nc/4.0/ All the content of the journal, except where otherwise noted, is licensed under a Creative Commons License CC BY-NC.
spellingShingle Environmental Microbiology
Santhyia, Anix Vivek
Mulloorpeedikayil, Rosalind George
Kollanoor, Riji John
Jeyaseelan, Prince M.J.
Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title_full Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title_fullStr Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title_full_unstemmed Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title_short Molecular variations in Vibrio alginolyticus and V. harveyi in shrimp-farming systems upon stress
title_sort molecular variations in vibrio alginolyticus and v. harveyi in shrimp-farming systems upon stress
topic Environmental Microbiology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4704611/
https://www.ncbi.nlm.nih.gov/pubmed/26691457
http://dx.doi.org/10.1590/S1517-838246420140410
work_keys_str_mv AT santhyiaanixvivek molecularvariationsinvibrioalginolyticusandvharveyiinshrimpfarmingsystemsuponstress
AT mulloorpeedikayilrosalindgeorge molecularvariationsinvibrioalginolyticusandvharveyiinshrimpfarmingsystemsuponstress
AT kollanoorrijijohn molecularvariationsinvibrioalginolyticusandvharveyiinshrimpfarmingsystemsuponstress
AT jeyaseelanprincemj molecularvariationsinvibrioalginolyticusandvharveyiinshrimpfarmingsystemsuponstress