Cargando…
Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform intern...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer US
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4710652/ https://www.ncbi.nlm.nih.gov/pubmed/26420672 http://dx.doi.org/10.1007/s10597-015-9954-5 |
_version_ | 1782409834495213568 |
---|---|
author | Balfour, Margaret E. Tanner, Kathleen Jurica, Paul J. Rhoads, Richard Carson, Chris A. |
author_facet | Balfour, Margaret E. Tanner, Kathleen Jurica, Paul J. Rhoads, Richard Carson, Chris A. |
author_sort | Balfour, Margaret E. |
collection | PubMed |
description | Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform internal performance improvement initiatives and allow comparison across programs. The framework consists of two components—the CRISES domains (timely, safe, accessible, least-restrictive, effective, consumer/family centered, and partnership) and the measures supporting each domain. The CRISES framework provides a foundation for development of standardized measures for the crisis field. This will become increasingly important as pay-for-performance initiatives expand with healthcare reform. |
format | Online Article Text |
id | pubmed-4710652 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Springer US |
record_format | MEDLINE/PubMed |
spelling | pubmed-47106522016-01-19 Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs Balfour, Margaret E. Tanner, Kathleen Jurica, Paul J. Rhoads, Richard Carson, Chris A. Community Ment Health J Original Paper Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform internal performance improvement initiatives and allow comparison across programs. The framework consists of two components—the CRISES domains (timely, safe, accessible, least-restrictive, effective, consumer/family centered, and partnership) and the measures supporting each domain. The CRISES framework provides a foundation for development of standardized measures for the crisis field. This will become increasingly important as pay-for-performance initiatives expand with healthcare reform. Springer US 2015-09-29 2016 /pmc/articles/PMC4710652/ /pubmed/26420672 http://dx.doi.org/10.1007/s10597-015-9954-5 Text en © The Author(s) 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. |
spellingShingle | Original Paper Balfour, Margaret E. Tanner, Kathleen Jurica, Paul J. Rhoads, Richard Carson, Chris A. Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title | Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title_full | Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title_fullStr | Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title_full_unstemmed | Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title_short | Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs |
title_sort | crisis reliability indicators supporting emergency services (crises): a framework for developing performance measures for behavioral health crisis and psychiatric emergency programs |
topic | Original Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4710652/ https://www.ncbi.nlm.nih.gov/pubmed/26420672 http://dx.doi.org/10.1007/s10597-015-9954-5 |
work_keys_str_mv | AT balfourmargarete crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms AT tannerkathleen crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms AT juricapaulj crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms AT rhoadsrichard crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms AT carsonchrisa crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms |