Cargando…

Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs

Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform intern...

Descripción completa

Detalles Bibliográficos
Autores principales: Balfour, Margaret E., Tanner, Kathleen, Jurica, Paul J., Rhoads, Richard, Carson, Chris A.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer US 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4710652/
https://www.ncbi.nlm.nih.gov/pubmed/26420672
http://dx.doi.org/10.1007/s10597-015-9954-5
_version_ 1782409834495213568
author Balfour, Margaret E.
Tanner, Kathleen
Jurica, Paul J.
Rhoads, Richard
Carson, Chris A.
author_facet Balfour, Margaret E.
Tanner, Kathleen
Jurica, Paul J.
Rhoads, Richard
Carson, Chris A.
author_sort Balfour, Margaret E.
collection PubMed
description Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform internal performance improvement initiatives and allow comparison across programs. The framework consists of two components—the CRISES domains (timely, safe, accessible, least-restrictive, effective, consumer/family centered, and partnership) and the measures supporting each domain. The CRISES framework provides a foundation for development of standardized measures for the crisis field. This will become increasingly important as pay-for-performance initiatives expand with healthcare reform.
format Online
Article
Text
id pubmed-4710652
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Springer US
record_format MEDLINE/PubMed
spelling pubmed-47106522016-01-19 Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs Balfour, Margaret E. Tanner, Kathleen Jurica, Paul J. Rhoads, Richard Carson, Chris A. Community Ment Health J Original Paper Crisis and emergency psychiatric services are an integral part of the healthcare system, yet there are no standardized measures for programs providing these services. We developed the Crisis Reliability Indicators Supporting Emergency Services (CRISES) framework to create measures that inform internal performance improvement initiatives and allow comparison across programs. The framework consists of two components—the CRISES domains (timely, safe, accessible, least-restrictive, effective, consumer/family centered, and partnership) and the measures supporting each domain. The CRISES framework provides a foundation for development of standardized measures for the crisis field. This will become increasingly important as pay-for-performance initiatives expand with healthcare reform. Springer US 2015-09-29 2016 /pmc/articles/PMC4710652/ /pubmed/26420672 http://dx.doi.org/10.1007/s10597-015-9954-5 Text en © The Author(s) 2015 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made.
spellingShingle Original Paper
Balfour, Margaret E.
Tanner, Kathleen
Jurica, Paul J.
Rhoads, Richard
Carson, Chris A.
Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title_full Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title_fullStr Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title_full_unstemmed Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title_short Crisis Reliability Indicators Supporting Emergency Services (CRISES): A Framework for Developing Performance Measures for Behavioral Health Crisis and Psychiatric Emergency Programs
title_sort crisis reliability indicators supporting emergency services (crises): a framework for developing performance measures for behavioral health crisis and psychiatric emergency programs
topic Original Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4710652/
https://www.ncbi.nlm.nih.gov/pubmed/26420672
http://dx.doi.org/10.1007/s10597-015-9954-5
work_keys_str_mv AT balfourmargarete crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms
AT tannerkathleen crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms
AT juricapaulj crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms
AT rhoadsrichard crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms
AT carsonchrisa crisisreliabilityindicatorssupportingemergencyservicescrisesaframeworkfordevelopingperformancemeasuresforbehavioralhealthcrisisandpsychiatricemergencyprograms