Cargando…

Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation

Atrial fibrillation (AF) is the most common sustained cardiac arrhythmia. Previous genome-wide association studies had identified single-nucleotide polymorphisms in several genomic regions to be associated with AF. In human genome, copy number variations (CNVs) are known to contribute to disease sus...

Descripción completa

Detalles Bibliográficos
Autores principales: Tsai, Chia-Ti, Hsieh, Chia-Shan, Chang, Sheng-Nan, Chuang, Eric Y., Ueng, Kwo-Chang, Tsai, Chin-Feng, Lin, Tsung-Hsien, Wu, Cho-Kai, Lee, Jen-Kuang, Lin, Lian-Yu, Wang, Yi-Chih, Yu, Chih-Chieh, Lai, Ling-Ping, Tseng, Chuen-Den, Hwang, Juey-Jen, Chiang, Fu-Tien, Lin, Jiunn-Lee
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4740744/
https://www.ncbi.nlm.nih.gov/pubmed/26831368
http://dx.doi.org/10.1038/ncomms10190
_version_ 1782413879499816960
author Tsai, Chia-Ti
Hsieh, Chia-Shan
Chang, Sheng-Nan
Chuang, Eric Y.
Ueng, Kwo-Chang
Tsai, Chin-Feng
Lin, Tsung-Hsien
Wu, Cho-Kai
Lee, Jen-Kuang
Lin, Lian-Yu
Wang, Yi-Chih
Yu, Chih-Chieh
Lai, Ling-Ping
Tseng, Chuen-Den
Hwang, Juey-Jen
Chiang, Fu-Tien
Lin, Jiunn-Lee
author_facet Tsai, Chia-Ti
Hsieh, Chia-Shan
Chang, Sheng-Nan
Chuang, Eric Y.
Ueng, Kwo-Chang
Tsai, Chin-Feng
Lin, Tsung-Hsien
Wu, Cho-Kai
Lee, Jen-Kuang
Lin, Lian-Yu
Wang, Yi-Chih
Yu, Chih-Chieh
Lai, Ling-Ping
Tseng, Chuen-Den
Hwang, Juey-Jen
Chiang, Fu-Tien
Lin, Jiunn-Lee
author_sort Tsai, Chia-Ti
collection PubMed
description Atrial fibrillation (AF) is the most common sustained cardiac arrhythmia. Previous genome-wide association studies had identified single-nucleotide polymorphisms in several genomic regions to be associated with AF. In human genome, copy number variations (CNVs) are known to contribute to disease susceptibility. Using a genome-wide multistage approach to identify AF susceptibility CNVs, we here show a common 4,470-bp diallelic CNV in the first intron of potassium interacting channel 1 gene (KCNIP1) is strongly associated with AF in Taiwanese populations (odds ratio=2.27 for insertion allele; P=6.23 × 10(−24)). KCNIP1 insertion is associated with higher KCNIP1 mRNA expression. KCNIP1-encoded protein potassium interacting channel 1 (KCHIP1) is physically associated with potassium Kv channels and modulates atrial transient outward current in cardiac myocytes. Overexpression of KCNIP1 results in inducible AF in zebrafish. In conclusions, a common CNV in KCNIP1 gene is a genetic predictor of AF risk possibly pointing to a functional pathway.
format Online
Article
Text
id pubmed-4740744
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-47407442016-03-04 Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation Tsai, Chia-Ti Hsieh, Chia-Shan Chang, Sheng-Nan Chuang, Eric Y. Ueng, Kwo-Chang Tsai, Chin-Feng Lin, Tsung-Hsien Wu, Cho-Kai Lee, Jen-Kuang Lin, Lian-Yu Wang, Yi-Chih Yu, Chih-Chieh Lai, Ling-Ping Tseng, Chuen-Den Hwang, Juey-Jen Chiang, Fu-Tien Lin, Jiunn-Lee Nat Commun Article Atrial fibrillation (AF) is the most common sustained cardiac arrhythmia. Previous genome-wide association studies had identified single-nucleotide polymorphisms in several genomic regions to be associated with AF. In human genome, copy number variations (CNVs) are known to contribute to disease susceptibility. Using a genome-wide multistage approach to identify AF susceptibility CNVs, we here show a common 4,470-bp diallelic CNV in the first intron of potassium interacting channel 1 gene (KCNIP1) is strongly associated with AF in Taiwanese populations (odds ratio=2.27 for insertion allele; P=6.23 × 10(−24)). KCNIP1 insertion is associated with higher KCNIP1 mRNA expression. KCNIP1-encoded protein potassium interacting channel 1 (KCHIP1) is physically associated with potassium Kv channels and modulates atrial transient outward current in cardiac myocytes. Overexpression of KCNIP1 results in inducible AF in zebrafish. In conclusions, a common CNV in KCNIP1 gene is a genetic predictor of AF risk possibly pointing to a functional pathway. Nature Publishing Group 2016-02-02 /pmc/articles/PMC4740744/ /pubmed/26831368 http://dx.doi.org/10.1038/ncomms10190 Text en Copyright © 2016, Nature Publishing Group, a division of Macmillan Publishers Limited. All Rights Reserved. http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article's Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
spellingShingle Article
Tsai, Chia-Ti
Hsieh, Chia-Shan
Chang, Sheng-Nan
Chuang, Eric Y.
Ueng, Kwo-Chang
Tsai, Chin-Feng
Lin, Tsung-Hsien
Wu, Cho-Kai
Lee, Jen-Kuang
Lin, Lian-Yu
Wang, Yi-Chih
Yu, Chih-Chieh
Lai, Ling-Ping
Tseng, Chuen-Den
Hwang, Juey-Jen
Chiang, Fu-Tien
Lin, Jiunn-Lee
Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title_full Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title_fullStr Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title_full_unstemmed Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title_short Genome-wide screening identifies a KCNIP1 copy number variant as a genetic predictor for atrial fibrillation
title_sort genome-wide screening identifies a kcnip1 copy number variant as a genetic predictor for atrial fibrillation
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4740744/
https://www.ncbi.nlm.nih.gov/pubmed/26831368
http://dx.doi.org/10.1038/ncomms10190
work_keys_str_mv AT tsaichiati genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT hsiehchiashan genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT changshengnan genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT chuangericy genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT uengkwochang genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT tsaichinfeng genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT lintsunghsien genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT wuchokai genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT leejenkuang genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT linlianyu genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT wangyichih genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT yuchihchieh genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT lailingping genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT tsengchuenden genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT hwangjueyjen genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT chiangfutien genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation
AT linjiunnlee genomewidescreeningidentifiesakcnip1copynumbervariantasageneticpredictorforatrialfibrillation