Cargando…

Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study

Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observ...

Descripción completa

Detalles Bibliográficos
Autores principales: Baba, Hideo, Baba, Yoshifumi, Uemoto, Shinji, Yoshida, Kazuhiro, Saiura, Akio, Watanabe, Masayuki, Maehara, Yoshihiko, Oki, Eiji, Ikeda, Yasuharu, Matsuda, Hiroyuki, Yamamoto, Masakazu, Shimada, Mitsuo, Taketomi, Akinobu, Unno, Michiaki, Sugihara, Kenichi, Ogata, Yutaka, Eguchi, Susumu, Kitano, Seigo, Shirouzu, Kazuo, Saiki, Yasumitsu, Takamori, Hiroshi, Mori, Masaki, Hirata, Toshihiko, Wakabayashi, Go, Kokudo, Norihiro
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4741821/
https://www.ncbi.nlm.nih.gov/pubmed/26372896
_version_ 1782414077846355968
author Baba, Hideo
Baba, Yoshifumi
Uemoto, Shinji
Yoshida, Kazuhiro
Saiura, Akio
Watanabe, Masayuki
Maehara, Yoshihiko
Oki, Eiji
Ikeda, Yasuharu
Matsuda, Hiroyuki
Yamamoto, Masakazu
Shimada, Mitsuo
Taketomi, Akinobu
Unno, Michiaki
Sugihara, Kenichi
Ogata, Yutaka
Eguchi, Susumu
Kitano, Seigo
Shirouzu, Kazuo
Saiki, Yasumitsu
Takamori, Hiroshi
Mori, Masaki
Hirata, Toshihiko
Wakabayashi, Go
Kokudo, Norihiro
author_facet Baba, Hideo
Baba, Yoshifumi
Uemoto, Shinji
Yoshida, Kazuhiro
Saiura, Akio
Watanabe, Masayuki
Maehara, Yoshihiko
Oki, Eiji
Ikeda, Yasuharu
Matsuda, Hiroyuki
Yamamoto, Masakazu
Shimada, Mitsuo
Taketomi, Akinobu
Unno, Michiaki
Sugihara, Kenichi
Ogata, Yutaka
Eguchi, Susumu
Kitano, Seigo
Shirouzu, Kazuo
Saiki, Yasumitsu
Takamori, Hiroshi
Mori, Masaki
Hirata, Toshihiko
Wakabayashi, Go
Kokudo, Norihiro
author_sort Baba, Hideo
collection PubMed
description Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observational study to validate our previous findings on ERCC1 and DPD, and clarify the response of VEGFA expression to bavacizumab administration. 346 CRC patients with liver metastases were enrolled at 22 Japanese institutes. Resected liver metastases were available for 175 patients previously treated with oxaliplatin-based chemotherapy (chemotherapy group) and 171 receiving no previous chemotherapy (non-chemotherapy group). ERCC1, DPYD, and VEGFA mRNA levels were measured by real-time RT-PCR. ERCC1 mRNA expression was significantly higher in the chemotherapy group than in the non-chemotherapy group (P = 0.033), and were significantly correlated (Spearman's correlation coefficient = 0.42; P < 0.0001). VEGFA expression level was higher in patients receiving bevacizumab (n = 51) than in those who did not (n = 251) (P = 0.007). This study confirmed that first-line oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels, potentially enhancing chemosensitivity to subsequent therapy. We also found that bevacizumab induces VEGFA expression in tumor cells, suggesting a biologic rationale for extending bevacizumab treatment beyond first progression.
format Online
Article
Text
id pubmed-4741821
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-47418212016-03-11 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study Baba, Hideo Baba, Yoshifumi Uemoto, Shinji Yoshida, Kazuhiro Saiura, Akio Watanabe, Masayuki Maehara, Yoshihiko Oki, Eiji Ikeda, Yasuharu Matsuda, Hiroyuki Yamamoto, Masakazu Shimada, Mitsuo Taketomi, Akinobu Unno, Michiaki Sugihara, Kenichi Ogata, Yutaka Eguchi, Susumu Kitano, Seigo Shirouzu, Kazuo Saiki, Yasumitsu Takamori, Hiroshi Mori, Masaki Hirata, Toshihiko Wakabayashi, Go Kokudo, Norihiro Oncotarget Clinical Research Paper Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observational study to validate our previous findings on ERCC1 and DPD, and clarify the response of VEGFA expression to bavacizumab administration. 346 CRC patients with liver metastases were enrolled at 22 Japanese institutes. Resected liver metastases were available for 175 patients previously treated with oxaliplatin-based chemotherapy (chemotherapy group) and 171 receiving no previous chemotherapy (non-chemotherapy group). ERCC1, DPYD, and VEGFA mRNA levels were measured by real-time RT-PCR. ERCC1 mRNA expression was significantly higher in the chemotherapy group than in the non-chemotherapy group (P = 0.033), and were significantly correlated (Spearman's correlation coefficient = 0.42; P < 0.0001). VEGFA expression level was higher in patients receiving bevacizumab (n = 51) than in those who did not (n = 251) (P = 0.007). This study confirmed that first-line oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels, potentially enhancing chemosensitivity to subsequent therapy. We also found that bevacizumab induces VEGFA expression in tumor cells, suggesting a biologic rationale for extending bevacizumab treatment beyond first progression. Impact Journals LLC 2015-08-19 /pmc/articles/PMC4741821/ /pubmed/26372896 Text en Copyright: © 2015 Baba et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Clinical Research Paper
Baba, Hideo
Baba, Yoshifumi
Uemoto, Shinji
Yoshida, Kazuhiro
Saiura, Akio
Watanabe, Masayuki
Maehara, Yoshihiko
Oki, Eiji
Ikeda, Yasuharu
Matsuda, Hiroyuki
Yamamoto, Masakazu
Shimada, Mitsuo
Taketomi, Akinobu
Unno, Michiaki
Sugihara, Kenichi
Ogata, Yutaka
Eguchi, Susumu
Kitano, Seigo
Shirouzu, Kazuo
Saiki, Yasumitsu
Takamori, Hiroshi
Mori, Masaki
Hirata, Toshihiko
Wakabayashi, Go
Kokudo, Norihiro
Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title_full Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title_fullStr Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title_full_unstemmed Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title_short Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
title_sort changes in expression levels of ercc1, dpyd, and vegfa mrna after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
topic Clinical Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4741821/
https://www.ncbi.nlm.nih.gov/pubmed/26372896
work_keys_str_mv AT babahideo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT babayoshifumi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT uemotoshinji changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT yoshidakazuhiro changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT saiuraakio changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT watanabemasayuki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT maeharayoshihiko changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT okieiji changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT ikedayasuharu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT matsudahiroyuki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT yamamotomasakazu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT shimadamitsuo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT taketomiakinobu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT unnomichiaki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT sugiharakenichi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT ogatayutaka changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT eguchisusumu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT kitanoseigo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT shirouzukazuo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT saikiyasumitsu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT takamorihiroshi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT morimasaki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT hiratatoshihiko changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT wakabayashigo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy
AT kokudonorihiro changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy