Cargando…
Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study
Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observ...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4741821/ https://www.ncbi.nlm.nih.gov/pubmed/26372896 |
_version_ | 1782414077846355968 |
---|---|
author | Baba, Hideo Baba, Yoshifumi Uemoto, Shinji Yoshida, Kazuhiro Saiura, Akio Watanabe, Masayuki Maehara, Yoshihiko Oki, Eiji Ikeda, Yasuharu Matsuda, Hiroyuki Yamamoto, Masakazu Shimada, Mitsuo Taketomi, Akinobu Unno, Michiaki Sugihara, Kenichi Ogata, Yutaka Eguchi, Susumu Kitano, Seigo Shirouzu, Kazuo Saiki, Yasumitsu Takamori, Hiroshi Mori, Masaki Hirata, Toshihiko Wakabayashi, Go Kokudo, Norihiro |
author_facet | Baba, Hideo Baba, Yoshifumi Uemoto, Shinji Yoshida, Kazuhiro Saiura, Akio Watanabe, Masayuki Maehara, Yoshihiko Oki, Eiji Ikeda, Yasuharu Matsuda, Hiroyuki Yamamoto, Masakazu Shimada, Mitsuo Taketomi, Akinobu Unno, Michiaki Sugihara, Kenichi Ogata, Yutaka Eguchi, Susumu Kitano, Seigo Shirouzu, Kazuo Saiki, Yasumitsu Takamori, Hiroshi Mori, Masaki Hirata, Toshihiko Wakabayashi, Go Kokudo, Norihiro |
author_sort | Baba, Hideo |
collection | PubMed |
description | Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observational study to validate our previous findings on ERCC1 and DPD, and clarify the response of VEGFA expression to bavacizumab administration. 346 CRC patients with liver metastases were enrolled at 22 Japanese institutes. Resected liver metastases were available for 175 patients previously treated with oxaliplatin-based chemotherapy (chemotherapy group) and 171 receiving no previous chemotherapy (non-chemotherapy group). ERCC1, DPYD, and VEGFA mRNA levels were measured by real-time RT-PCR. ERCC1 mRNA expression was significantly higher in the chemotherapy group than in the non-chemotherapy group (P = 0.033), and were significantly correlated (Spearman's correlation coefficient = 0.42; P < 0.0001). VEGFA expression level was higher in patients receiving bevacizumab (n = 51) than in those who did not (n = 251) (P = 0.007). This study confirmed that first-line oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels, potentially enhancing chemosensitivity to subsequent therapy. We also found that bevacizumab induces VEGFA expression in tumor cells, suggesting a biologic rationale for extending bevacizumab treatment beyond first progression. |
format | Online Article Text |
id | pubmed-4741821 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-47418212016-03-11 Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study Baba, Hideo Baba, Yoshifumi Uemoto, Shinji Yoshida, Kazuhiro Saiura, Akio Watanabe, Masayuki Maehara, Yoshihiko Oki, Eiji Ikeda, Yasuharu Matsuda, Hiroyuki Yamamoto, Masakazu Shimada, Mitsuo Taketomi, Akinobu Unno, Michiaki Sugihara, Kenichi Ogata, Yutaka Eguchi, Susumu Kitano, Seigo Shirouzu, Kazuo Saiki, Yasumitsu Takamori, Hiroshi Mori, Masaki Hirata, Toshihiko Wakabayashi, Go Kokudo, Norihiro Oncotarget Clinical Research Paper Our previous study showed that administering oxaliplatin as first-line chemotherapy increased ERCC1 and DPD levels in liver colorectal cancers (CRCs) metastases. Second, whether the anti-VEGF monoclonal antibody bevacizumab alters tumoral VEGFA levels is unknown. We conducted this multicenter observational study to validate our previous findings on ERCC1 and DPD, and clarify the response of VEGFA expression to bavacizumab administration. 346 CRC patients with liver metastases were enrolled at 22 Japanese institutes. Resected liver metastases were available for 175 patients previously treated with oxaliplatin-based chemotherapy (chemotherapy group) and 171 receiving no previous chemotherapy (non-chemotherapy group). ERCC1, DPYD, and VEGFA mRNA levels were measured by real-time RT-PCR. ERCC1 mRNA expression was significantly higher in the chemotherapy group than in the non-chemotherapy group (P = 0.033), and were significantly correlated (Spearman's correlation coefficient = 0.42; P < 0.0001). VEGFA expression level was higher in patients receiving bevacizumab (n = 51) than in those who did not (n = 251) (P = 0.007). This study confirmed that first-line oxaliplatin-based chemotherapy increases ERCC1 and DPYD expression levels, potentially enhancing chemosensitivity to subsequent therapy. We also found that bevacizumab induces VEGFA expression in tumor cells, suggesting a biologic rationale for extending bevacizumab treatment beyond first progression. Impact Journals LLC 2015-08-19 /pmc/articles/PMC4741821/ /pubmed/26372896 Text en Copyright: © 2015 Baba et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Clinical Research Paper Baba, Hideo Baba, Yoshifumi Uemoto, Shinji Yoshida, Kazuhiro Saiura, Akio Watanabe, Masayuki Maehara, Yoshihiko Oki, Eiji Ikeda, Yasuharu Matsuda, Hiroyuki Yamamoto, Masakazu Shimada, Mitsuo Taketomi, Akinobu Unno, Michiaki Sugihara, Kenichi Ogata, Yutaka Eguchi, Susumu Kitano, Seigo Shirouzu, Kazuo Saiki, Yasumitsu Takamori, Hiroshi Mori, Masaki Hirata, Toshihiko Wakabayashi, Go Kokudo, Norihiro Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title | Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title_full | Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title_fullStr | Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title_full_unstemmed | Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title_short | Changes in expression levels of ERCC1, DPYD, and VEGFA mRNA after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
title_sort | changes in expression levels of ercc1, dpyd, and vegfa mrna after first-line chemotherapy of metastatic colorectal cancer: results of a multicenter study |
topic | Clinical Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4741821/ https://www.ncbi.nlm.nih.gov/pubmed/26372896 |
work_keys_str_mv | AT babahideo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT babayoshifumi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT uemotoshinji changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT yoshidakazuhiro changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT saiuraakio changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT watanabemasayuki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT maeharayoshihiko changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT okieiji changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT ikedayasuharu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT matsudahiroyuki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT yamamotomasakazu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT shimadamitsuo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT taketomiakinobu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT unnomichiaki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT sugiharakenichi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT ogatayutaka changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT eguchisusumu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT kitanoseigo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT shirouzukazuo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT saikiyasumitsu changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT takamorihiroshi changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT morimasaki changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT hiratatoshihiko changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT wakabayashigo changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy AT kokudonorihiro changesinexpressionlevelsofercc1dpydandvegfamrnaafterfirstlinechemotherapyofmetastaticcolorectalcancerresultsofamulticenterstudy |