Cargando…
Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and s...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759919/ https://www.ncbi.nlm.nih.gov/pubmed/26895761 http://dx.doi.org/10.1186/s12875-016-0421-3 |
_version_ | 1782416811388567552 |
---|---|
author | van Dijk, Christel E. Smit, Lidwien A. M. Hooiveld, Mariette Zock, Jan-Paul Wouters, Inge M. Heederik, Dick J. J. Yzermans, C. Joris |
author_facet | van Dijk, Christel E. Smit, Lidwien A. M. Hooiveld, Mariette Zock, Jan-Paul Wouters, Inge M. Heederik, Dick J. J. Yzermans, C. Joris |
author_sort | van Dijk, Christel E. |
collection | PubMed |
description | BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and self-reported symptoms. In addition, we examined the potentially confounding effect of distance from home to general practice. METHODS: Contact data between 2006 and 2009 were obtained from electronic medical records of 54,777 persons registered within 16 general practices in an area with a high density of livestock farms in the Netherlands. Data on self-reported symptoms were used from a cross-sectional sample of 531 patients in 2010. Livestock presence in a 500 m radius from home was computed using Geographic Information System data. RESULTS: In general, livestock exposure was associated with fewer contacts and self-reported symptoms for respiratory and other conditions. The number of poultry within 500 m was positively associated with the number of contacts. A longer distance to general practice was associated with fewer contacts, but did not confound associations. CONCLUSIONS: People living close to livestock farms less often see their general practitioner and report symptoms. |
format | Online Article Text |
id | pubmed-4759919 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47599192016-02-20 Associations between proximity to livestock farms, primary health care visits and self-reported symptoms van Dijk, Christel E. Smit, Lidwien A. M. Hooiveld, Mariette Zock, Jan-Paul Wouters, Inge M. Heederik, Dick J. J. Yzermans, C. Joris BMC Fam Pract Research Article BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and self-reported symptoms. In addition, we examined the potentially confounding effect of distance from home to general practice. METHODS: Contact data between 2006 and 2009 were obtained from electronic medical records of 54,777 persons registered within 16 general practices in an area with a high density of livestock farms in the Netherlands. Data on self-reported symptoms were used from a cross-sectional sample of 531 patients in 2010. Livestock presence in a 500 m radius from home was computed using Geographic Information System data. RESULTS: In general, livestock exposure was associated with fewer contacts and self-reported symptoms for respiratory and other conditions. The number of poultry within 500 m was positively associated with the number of contacts. A longer distance to general practice was associated with fewer contacts, but did not confound associations. CONCLUSIONS: People living close to livestock farms less often see their general practitioner and report symptoms. BioMed Central 2016-02-19 /pmc/articles/PMC4759919/ /pubmed/26895761 http://dx.doi.org/10.1186/s12875-016-0421-3 Text en © van Dijk et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article van Dijk, Christel E. Smit, Lidwien A. M. Hooiveld, Mariette Zock, Jan-Paul Wouters, Inge M. Heederik, Dick J. J. Yzermans, C. Joris Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title | Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title_full | Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title_fullStr | Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title_full_unstemmed | Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title_short | Associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
title_sort | associations between proximity to livestock farms, primary health care visits and self-reported symptoms |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759919/ https://www.ncbi.nlm.nih.gov/pubmed/26895761 http://dx.doi.org/10.1186/s12875-016-0421-3 |
work_keys_str_mv | AT vandijkchristele associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT smitlidwienam associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT hooiveldmariette associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT zockjanpaul associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT woutersingem associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT heederikdickjj associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms AT yzermanscjoris associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms |