Cargando…

Associations between proximity to livestock farms, primary health care visits and self-reported symptoms

BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and s...

Descripción completa

Detalles Bibliográficos
Autores principales: van Dijk, Christel E., Smit, Lidwien A. M., Hooiveld, Mariette, Zock, Jan-Paul, Wouters, Inge M., Heederik, Dick J. J., Yzermans, C. Joris
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759919/
https://www.ncbi.nlm.nih.gov/pubmed/26895761
http://dx.doi.org/10.1186/s12875-016-0421-3
_version_ 1782416811388567552
author van Dijk, Christel E.
Smit, Lidwien A. M.
Hooiveld, Mariette
Zock, Jan-Paul
Wouters, Inge M.
Heederik, Dick J. J.
Yzermans, C. Joris
author_facet van Dijk, Christel E.
Smit, Lidwien A. M.
Hooiveld, Mariette
Zock, Jan-Paul
Wouters, Inge M.
Heederik, Dick J. J.
Yzermans, C. Joris
author_sort van Dijk, Christel E.
collection PubMed
description BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and self-reported symptoms. In addition, we examined the potentially confounding effect of distance from home to general practice. METHODS: Contact data between 2006 and 2009 were obtained from electronic medical records of 54,777 persons registered within 16 general practices in an area with a high density of livestock farms in the Netherlands. Data on self-reported symptoms were used from a cross-sectional sample of 531 patients in 2010. Livestock presence in a 500 m radius from home was computed using Geographic Information System data. RESULTS: In general, livestock exposure was associated with fewer contacts and self-reported symptoms for respiratory and other conditions. The number of poultry within 500 m was positively associated with the number of contacts. A longer distance to general practice was associated with fewer contacts, but did not confound associations. CONCLUSIONS: People living close to livestock farms less often see their general practitioner and report symptoms.
format Online
Article
Text
id pubmed-4759919
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-47599192016-02-20 Associations between proximity to livestock farms, primary health care visits and self-reported symptoms van Dijk, Christel E. Smit, Lidwien A. M. Hooiveld, Mariette Zock, Jan-Paul Wouters, Inge M. Heederik, Dick J. J. Yzermans, C. Joris BMC Fam Pract Research Article BACKGROUND: Living in a neighbourhood with a high density of livestock farms has been associated with adverse respiratory health effects, but less is known about healthcare utilisation. This study aimed at investigating the associations between livestock exposure and primary health care visits and self-reported symptoms. In addition, we examined the potentially confounding effect of distance from home to general practice. METHODS: Contact data between 2006 and 2009 were obtained from electronic medical records of 54,777 persons registered within 16 general practices in an area with a high density of livestock farms in the Netherlands. Data on self-reported symptoms were used from a cross-sectional sample of 531 patients in 2010. Livestock presence in a 500 m radius from home was computed using Geographic Information System data. RESULTS: In general, livestock exposure was associated with fewer contacts and self-reported symptoms for respiratory and other conditions. The number of poultry within 500 m was positively associated with the number of contacts. A longer distance to general practice was associated with fewer contacts, but did not confound associations. CONCLUSIONS: People living close to livestock farms less often see their general practitioner and report symptoms. BioMed Central 2016-02-19 /pmc/articles/PMC4759919/ /pubmed/26895761 http://dx.doi.org/10.1186/s12875-016-0421-3 Text en © van Dijk et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
van Dijk, Christel E.
Smit, Lidwien A. M.
Hooiveld, Mariette
Zock, Jan-Paul
Wouters, Inge M.
Heederik, Dick J. J.
Yzermans, C. Joris
Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title_full Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title_fullStr Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title_full_unstemmed Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title_short Associations between proximity to livestock farms, primary health care visits and self-reported symptoms
title_sort associations between proximity to livestock farms, primary health care visits and self-reported symptoms
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759919/
https://www.ncbi.nlm.nih.gov/pubmed/26895761
http://dx.doi.org/10.1186/s12875-016-0421-3
work_keys_str_mv AT vandijkchristele associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT smitlidwienam associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT hooiveldmariette associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT zockjanpaul associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT woutersingem associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT heederikdickjj associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms
AT yzermanscjoris associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms