Cargando…
BMC Emergency Medicine reviewer acknowledgement 2015
The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 15 (2015)
| Autor principal: | |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2016
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759949/ http://dx.doi.org/10.1186/s12873-016-0077-2 |
| _version_ | 1782416815967698944 |
|---|---|
| author | Mangiameli, Giulia |
| author_facet | Mangiameli, Giulia |
| author_sort | Mangiameli, Giulia |
| collection | PubMed |
| description | The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 15 (2015) |
| format | Online Article Text |
| id | pubmed-4759949 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2016 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-47599492016-02-20 BMC Emergency Medicine reviewer acknowledgement 2015 Mangiameli, Giulia BMC Emerg Med Reviewer Acknowledgement The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 15 (2015) BioMed Central 2016-02-18 /pmc/articles/PMC4759949/ http://dx.doi.org/10.1186/s12873-016-0077-2 Text en © Mangiameli. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Reviewer Acknowledgement Mangiameli, Giulia BMC Emergency Medicine reviewer acknowledgement 2015 |
| title | BMC Emergency Medicine reviewer acknowledgement 2015 |
| title_full | BMC Emergency Medicine reviewer acknowledgement 2015 |
| title_fullStr | BMC Emergency Medicine reviewer acknowledgement 2015 |
| title_full_unstemmed | BMC Emergency Medicine reviewer acknowledgement 2015 |
| title_short | BMC Emergency Medicine reviewer acknowledgement 2015 |
| title_sort | bmc emergency medicine reviewer acknowledgement 2015 |
| topic | Reviewer Acknowledgement |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4759949/ http://dx.doi.org/10.1186/s12873-016-0077-2 |
| work_keys_str_mv | AT mangiameligiulia bmcemergencymedicinerevieweracknowledgement2015 |