Cargando…
Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and ev...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761180/ https://www.ncbi.nlm.nih.gov/pubmed/26895969 http://dx.doi.org/10.1186/s12906-016-1038-8 |
_version_ | 1782416944546185216 |
---|---|
author | Liu, Xue-ting Ren, Peng-wei Peng, Le Kang, De-ying Zhang, Tian-le Wen, Shu Hong, Qi Yang, Wen-jie |
author_facet | Liu, Xue-ting Ren, Peng-wei Peng, Le Kang, De-ying Zhang, Tian-le Wen, Shu Hong, Qi Yang, Wen-jie |
author_sort | Liu, Xue-ting |
collection | PubMed |
description | BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and evaluation, GRADE). METHODS: A literature search was performed in the Cochrane Library, MEDLINE, EMBASE, CBM, Chinese TCM (traditional Chinese medicine) Database, CNKI, VIP, WanFang Databases until January 2015. The limits were patients with AIS and randomized controlled trials (RCTs) or quasi-RCTs. Studies by which patients suffering intracerebral haemorrhage were excluded. RESULTS: Twelve studies fulfilled the inclusion criteria. We found significant benefits of ShenXiong glucose injection compared with conventional treatment in improving activities of daily living function at 4 weeks (MD = 34.12, 95 % CI: 29.07, 39.17), neurological function deficit at 2 weeks (MD = −5.39, 95 % CI: −6.90, −3.87), 4 weeks (MD = −5.16, 95 % CI: −6.49, −3.83), and clinical effects at 4 weeks (RR = 1.17, 95 % CI: 1.10, 1.24). No trials reported the effects of ShenXiong glucose injection on the risk of early, deterioration, or quality of life. No adverse events were reported within the whole follow-up period. CONCLUSIONS: The use of ShenXiong glucose injection may improve rehabilitation for patients with acute ischemic stroke, however, as the GRADE approach indicated low to moderate quality of available evidence as well as insufficient information about harm and patients preference, the recommendations were not provided for ShenXiong glucose injection taking as a therapeutic intervention to patients with acute ischemic stroke. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12906-016-1038-8) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4761180 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47611802016-02-21 Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach Liu, Xue-ting Ren, Peng-wei Peng, Le Kang, De-ying Zhang, Tian-le Wen, Shu Hong, Qi Yang, Wen-jie BMC Complement Altern Med Research Article BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and evaluation, GRADE). METHODS: A literature search was performed in the Cochrane Library, MEDLINE, EMBASE, CBM, Chinese TCM (traditional Chinese medicine) Database, CNKI, VIP, WanFang Databases until January 2015. The limits were patients with AIS and randomized controlled trials (RCTs) or quasi-RCTs. Studies by which patients suffering intracerebral haemorrhage were excluded. RESULTS: Twelve studies fulfilled the inclusion criteria. We found significant benefits of ShenXiong glucose injection compared with conventional treatment in improving activities of daily living function at 4 weeks (MD = 34.12, 95 % CI: 29.07, 39.17), neurological function deficit at 2 weeks (MD = −5.39, 95 % CI: −6.90, −3.87), 4 weeks (MD = −5.16, 95 % CI: −6.49, −3.83), and clinical effects at 4 weeks (RR = 1.17, 95 % CI: 1.10, 1.24). No trials reported the effects of ShenXiong glucose injection on the risk of early, deterioration, or quality of life. No adverse events were reported within the whole follow-up period. CONCLUSIONS: The use of ShenXiong glucose injection may improve rehabilitation for patients with acute ischemic stroke, however, as the GRADE approach indicated low to moderate quality of available evidence as well as insufficient information about harm and patients preference, the recommendations were not provided for ShenXiong glucose injection taking as a therapeutic intervention to patients with acute ischemic stroke. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12906-016-1038-8) contains supplementary material, which is available to authorized users. BioMed Central 2016-02-19 /pmc/articles/PMC4761180/ /pubmed/26895969 http://dx.doi.org/10.1186/s12906-016-1038-8 Text en © Liu et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Liu, Xue-ting Ren, Peng-wei Peng, Le Kang, De-ying Zhang, Tian-le Wen, Shu Hong, Qi Yang, Wen-jie Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title | Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title_full | Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title_fullStr | Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title_full_unstemmed | Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title_short | Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach |
title_sort | effectiveness and safety of shenxiong glucose injection for acute ischemic stroke: a systematic review and grade approach |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761180/ https://www.ncbi.nlm.nih.gov/pubmed/26895969 http://dx.doi.org/10.1186/s12906-016-1038-8 |
work_keys_str_mv | AT liuxueting effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT renpengwei effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT pengle effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT kangdeying effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT zhangtianle effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT wenshu effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT hongqi effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach AT yangwenjie effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach |