Cargando…

Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach

BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and ev...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Xue-ting, Ren, Peng-wei, Peng, Le, Kang, De-ying, Zhang, Tian-le, Wen, Shu, Hong, Qi, Yang, Wen-jie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761180/
https://www.ncbi.nlm.nih.gov/pubmed/26895969
http://dx.doi.org/10.1186/s12906-016-1038-8
_version_ 1782416944546185216
author Liu, Xue-ting
Ren, Peng-wei
Peng, Le
Kang, De-ying
Zhang, Tian-le
Wen, Shu
Hong, Qi
Yang, Wen-jie
author_facet Liu, Xue-ting
Ren, Peng-wei
Peng, Le
Kang, De-ying
Zhang, Tian-le
Wen, Shu
Hong, Qi
Yang, Wen-jie
author_sort Liu, Xue-ting
collection PubMed
description BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and evaluation, GRADE). METHODS: A literature search was performed in the Cochrane Library, MEDLINE, EMBASE, CBM, Chinese TCM (traditional Chinese medicine) Database, CNKI, VIP, WanFang Databases until January 2015. The limits were patients with AIS and randomized controlled trials (RCTs) or quasi-RCTs. Studies by which patients suffering intracerebral haemorrhage were excluded. RESULTS: Twelve studies fulfilled the inclusion criteria. We found significant benefits of ShenXiong glucose injection compared with conventional treatment in improving activities of daily living function at 4 weeks (MD = 34.12, 95 % CI: 29.07, 39.17), neurological function deficit at 2 weeks (MD = −5.39, 95 % CI: −6.90, −3.87), 4 weeks (MD = −5.16, 95 % CI: −6.49, −3.83), and clinical effects at 4 weeks (RR = 1.17, 95 % CI: 1.10, 1.24). No trials reported the effects of ShenXiong glucose injection on the risk of early, deterioration, or quality of life. No adverse events were reported within the whole follow-up period. CONCLUSIONS: The use of ShenXiong glucose injection may improve rehabilitation for patients with acute ischemic stroke, however, as the GRADE approach indicated low to moderate quality of available evidence as well as insufficient information about harm and patients preference, the recommendations were not provided for ShenXiong glucose injection taking as a therapeutic intervention to patients with acute ischemic stroke. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12906-016-1038-8) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4761180
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-47611802016-02-21 Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach Liu, Xue-ting Ren, Peng-wei Peng, Le Kang, De-ying Zhang, Tian-le Wen, Shu Hong, Qi Yang, Wen-jie BMC Complement Altern Med Research Article BACKGROUND: To appraise critically whether published trials of ShenXiong glucose injection for patients with acute ischemic stroke (AIS) are of sufficient quality, and in addition to rate the quality of evidence by using the GRADE approach (grading of recommendations, assessment, development, and evaluation, GRADE). METHODS: A literature search was performed in the Cochrane Library, MEDLINE, EMBASE, CBM, Chinese TCM (traditional Chinese medicine) Database, CNKI, VIP, WanFang Databases until January 2015. The limits were patients with AIS and randomized controlled trials (RCTs) or quasi-RCTs. Studies by which patients suffering intracerebral haemorrhage were excluded. RESULTS: Twelve studies fulfilled the inclusion criteria. We found significant benefits of ShenXiong glucose injection compared with conventional treatment in improving activities of daily living function at 4 weeks (MD = 34.12, 95 % CI: 29.07, 39.17), neurological function deficit at 2 weeks (MD = −5.39, 95 % CI: −6.90, −3.87), 4 weeks (MD = −5.16, 95 % CI: −6.49, −3.83), and clinical effects at 4 weeks (RR = 1.17, 95 % CI: 1.10, 1.24). No trials reported the effects of ShenXiong glucose injection on the risk of early, deterioration, or quality of life. No adverse events were reported within the whole follow-up period. CONCLUSIONS: The use of ShenXiong glucose injection may improve rehabilitation for patients with acute ischemic stroke, however, as the GRADE approach indicated low to moderate quality of available evidence as well as insufficient information about harm and patients preference, the recommendations were not provided for ShenXiong glucose injection taking as a therapeutic intervention to patients with acute ischemic stroke. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12906-016-1038-8) contains supplementary material, which is available to authorized users. BioMed Central 2016-02-19 /pmc/articles/PMC4761180/ /pubmed/26895969 http://dx.doi.org/10.1186/s12906-016-1038-8 Text en © Liu et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Liu, Xue-ting
Ren, Peng-wei
Peng, Le
Kang, De-ying
Zhang, Tian-le
Wen, Shu
Hong, Qi
Yang, Wen-jie
Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title_full Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title_fullStr Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title_full_unstemmed Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title_short Effectiveness and safety of ShenXiong glucose injection for acute ischemic stroke: a systematic review and GRADE approach
title_sort effectiveness and safety of shenxiong glucose injection for acute ischemic stroke: a systematic review and grade approach
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761180/
https://www.ncbi.nlm.nih.gov/pubmed/26895969
http://dx.doi.org/10.1186/s12906-016-1038-8
work_keys_str_mv AT liuxueting effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT renpengwei effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT pengle effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT kangdeying effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT zhangtianle effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT wenshu effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT hongqi effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach
AT yangwenjie effectivenessandsafetyofshenxiongglucoseinjectionforacuteischemicstrokeasystematicreviewandgradeapproach