Cargando…
Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions
BACKGROUND: Randomized controlled trials (RCTs) are the gold standard design of clinical research to assess interventions. However, RCTs cannot always be applied for practical or ethical reasons. To investigate the current practices in rare diseases, we review evaluations of therapeutic intervention...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761188/ https://www.ncbi.nlm.nih.gov/pubmed/26897367 http://dx.doi.org/10.1186/s13023-016-0402-6 |
_version_ | 1782416946433622016 |
---|---|
author | Unkel, Steffen Röver, Christian Stallard, Nigel Benda, Norbert Posch, Martin Zohar, Sarah Friede, Tim |
author_facet | Unkel, Steffen Röver, Christian Stallard, Nigel Benda, Norbert Posch, Martin Zohar, Sarah Friede, Tim |
author_sort | Unkel, Steffen |
collection | PubMed |
description | BACKGROUND: Randomized controlled trials (RCTs) are the gold standard design of clinical research to assess interventions. However, RCTs cannot always be applied for practical or ethical reasons. To investigate the current practices in rare diseases, we review evaluations of therapeutic interventions in paediatric multiple sclerosis (MS) and Creutzfeldt-Jakob disease (CJD). In particular, we shed light on the endpoints used, the study designs implemented and the statistical methodologies applied. METHODS: We conducted literature searches to identify relevant primary studies. Data on study design, objectives, endpoints, patient characteristics, randomization and masking, type of intervention, control, withdrawals and statistical methodology were extracted from the selected studies. The risk of bias and the quality of the studies were assessed. RESULTS: Twelve (seven) primary studies on paediatric MS (CJD) were included in the qualitative synthesis. No double-blind, randomized placebo-controlled trial for evaluating interventions in paediatric MS has been published yet. Evidence from one open-label RCT is available. The observational studies are before-after studies or controlled studies. Three of the seven selected studies on CJD are RCTs, of which two received the maximum mark on the Oxford Quality Scale. Four trials are controlled observational studies. CONCLUSIONS: Evidence from double-blind RCTs on the efficacy of treatments appears to be variable between rare diseases. With regard to paediatric conditions it remains to be seen what impact regulators will have through e.g., paediatric investigation plans. Overall, there is space for improvement by using innovative trial designs and data analysis techniques. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-016-0402-6) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4761188 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47611882016-02-21 Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions Unkel, Steffen Röver, Christian Stallard, Nigel Benda, Norbert Posch, Martin Zohar, Sarah Friede, Tim Orphanet J Rare Dis Research BACKGROUND: Randomized controlled trials (RCTs) are the gold standard design of clinical research to assess interventions. However, RCTs cannot always be applied for practical or ethical reasons. To investigate the current practices in rare diseases, we review evaluations of therapeutic interventions in paediatric multiple sclerosis (MS) and Creutzfeldt-Jakob disease (CJD). In particular, we shed light on the endpoints used, the study designs implemented and the statistical methodologies applied. METHODS: We conducted literature searches to identify relevant primary studies. Data on study design, objectives, endpoints, patient characteristics, randomization and masking, type of intervention, control, withdrawals and statistical methodology were extracted from the selected studies. The risk of bias and the quality of the studies were assessed. RESULTS: Twelve (seven) primary studies on paediatric MS (CJD) were included in the qualitative synthesis. No double-blind, randomized placebo-controlled trial for evaluating interventions in paediatric MS has been published yet. Evidence from one open-label RCT is available. The observational studies are before-after studies or controlled studies. Three of the seven selected studies on CJD are RCTs, of which two received the maximum mark on the Oxford Quality Scale. Four trials are controlled observational studies. CONCLUSIONS: Evidence from double-blind RCTs on the efficacy of treatments appears to be variable between rare diseases. With regard to paediatric conditions it remains to be seen what impact regulators will have through e.g., paediatric investigation plans. Overall, there is space for improvement by using innovative trial designs and data analysis techniques. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13023-016-0402-6) contains supplementary material, which is available to authorized users. BioMed Central 2016-02-20 /pmc/articles/PMC4761188/ /pubmed/26897367 http://dx.doi.org/10.1186/s13023-016-0402-6 Text en © Unkel et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Unkel, Steffen Röver, Christian Stallard, Nigel Benda, Norbert Posch, Martin Zohar, Sarah Friede, Tim Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title | Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title_full | Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title_fullStr | Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title_full_unstemmed | Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title_short | Systematic reviews in paediatric multiple sclerosis and Creutzfeldt-Jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
title_sort | systematic reviews in paediatric multiple sclerosis and creutzfeldt-jakob disease exemplify shortcomings in methods used to evaluate therapies in rare conditions |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4761188/ https://www.ncbi.nlm.nih.gov/pubmed/26897367 http://dx.doi.org/10.1186/s13023-016-0402-6 |
work_keys_str_mv | AT unkelsteffen systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT roverchristian systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT stallardnigel systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT bendanorbert systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT poschmartin systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT zoharsarah systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions AT friedetim systematicreviewsinpaediatricmultiplesclerosisandcreutzfeldtjakobdiseaseexemplifyshortcomingsinmethodsusedtoevaluatetherapiesinrareconditions |