Cargando…

Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device

BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who w...

Descripción completa

Detalles Bibliográficos
Autores principales: Miura, Gen, Nakamura, Yosuke, Sato, Eiju, Yamamoto, Shuichi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4779227/
https://www.ncbi.nlm.nih.gov/pubmed/26944722
http://dx.doi.org/10.1186/s12886-016-0200-x
_version_ 1782419599590948864
author Miura, Gen
Nakamura, Yosuke
Sato, Eiju
Yamamoto, Shuichi
author_facet Miura, Gen
Nakamura, Yosuke
Sato, Eiju
Yamamoto, Shuichi
author_sort Miura, Gen
collection PubMed
description BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who were pseudophakic. Flicker ERGs were recorded with the RETeval™ system (LKC Technologies, Gaithersburg, MD) under mydriatic-free condition with skin electrodes. Flicker ERGs were elicited by white light delivered at a frequency of 28.3 Hz and intensity of 8 Td-s. The implicit times and amplitudes of the ERGs recorded from the Grade 2 cataract, Grade 3 cataract, and pseudophakic groups were compared. RESULTS: The mean amplitude was significantly smaller in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P < 0.0001; Grade 3 cataract vs pseudophakic group, P < 0.0001; Grade 2 cataract vs Grade 3 cataract, P = 0.027). The mean implicit times was significantly longer in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P = 0.046; Grade 3 cataract vs pseudophakic group, P = 0.0004; Grade 2 cataract vs Grade 3 cataract, P = 0.0084). CONCLUSIONS: The results indicate that the presence of Grade 2 or more cataracts will affect both the amplitude and the implicit time of the flicker ERGs. The presence of cataracts should be taken into consideration when interpreting the flicker ERG recorded with RETeval™.
format Online
Article
Text
id pubmed-4779227
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-47792272016-03-06 Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device Miura, Gen Nakamura, Yosuke Sato, Eiju Yamamoto, Shuichi BMC Ophthalmol Research Article BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who were pseudophakic. Flicker ERGs were recorded with the RETeval™ system (LKC Technologies, Gaithersburg, MD) under mydriatic-free condition with skin electrodes. Flicker ERGs were elicited by white light delivered at a frequency of 28.3 Hz and intensity of 8 Td-s. The implicit times and amplitudes of the ERGs recorded from the Grade 2 cataract, Grade 3 cataract, and pseudophakic groups were compared. RESULTS: The mean amplitude was significantly smaller in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P < 0.0001; Grade 3 cataract vs pseudophakic group, P < 0.0001; Grade 2 cataract vs Grade 3 cataract, P = 0.027). The mean implicit times was significantly longer in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P = 0.046; Grade 3 cataract vs pseudophakic group, P = 0.0004; Grade 2 cataract vs Grade 3 cataract, P = 0.0084). CONCLUSIONS: The results indicate that the presence of Grade 2 or more cataracts will affect both the amplitude and the implicit time of the flicker ERGs. The presence of cataracts should be taken into consideration when interpreting the flicker ERG recorded with RETeval™. BioMed Central 2016-03-05 /pmc/articles/PMC4779227/ /pubmed/26944722 http://dx.doi.org/10.1186/s12886-016-0200-x Text en © Miura et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Miura, Gen
Nakamura, Yosuke
Sato, Eiju
Yamamoto, Shuichi
Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title_full Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title_fullStr Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title_full_unstemmed Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title_short Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
title_sort effects of cataracts on flicker electroretinograms recorded with reteval™ system: new mydriasis-free erg device
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4779227/
https://www.ncbi.nlm.nih.gov/pubmed/26944722
http://dx.doi.org/10.1186/s12886-016-0200-x
work_keys_str_mv AT miuragen effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice
AT nakamurayosuke effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice
AT satoeiju effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice
AT yamamotoshuichi effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice