Cargando…
Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device
BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who w...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4779227/ https://www.ncbi.nlm.nih.gov/pubmed/26944722 http://dx.doi.org/10.1186/s12886-016-0200-x |
_version_ | 1782419599590948864 |
---|---|
author | Miura, Gen Nakamura, Yosuke Sato, Eiju Yamamoto, Shuichi |
author_facet | Miura, Gen Nakamura, Yosuke Sato, Eiju Yamamoto, Shuichi |
author_sort | Miura, Gen |
collection | PubMed |
description | BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who were pseudophakic. Flicker ERGs were recorded with the RETeval™ system (LKC Technologies, Gaithersburg, MD) under mydriatic-free condition with skin electrodes. Flicker ERGs were elicited by white light delivered at a frequency of 28.3 Hz and intensity of 8 Td-s. The implicit times and amplitudes of the ERGs recorded from the Grade 2 cataract, Grade 3 cataract, and pseudophakic groups were compared. RESULTS: The mean amplitude was significantly smaller in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P < 0.0001; Grade 3 cataract vs pseudophakic group, P < 0.0001; Grade 2 cataract vs Grade 3 cataract, P = 0.027). The mean implicit times was significantly longer in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P = 0.046; Grade 3 cataract vs pseudophakic group, P = 0.0004; Grade 2 cataract vs Grade 3 cataract, P = 0.0084). CONCLUSIONS: The results indicate that the presence of Grade 2 or more cataracts will affect both the amplitude and the implicit time of the flicker ERGs. The presence of cataracts should be taken into consideration when interpreting the flicker ERG recorded with RETeval™. |
format | Online Article Text |
id | pubmed-4779227 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47792272016-03-06 Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device Miura, Gen Nakamura, Yosuke Sato, Eiju Yamamoto, Shuichi BMC Ophthalmol Research Article BACKGROUND: The purpose of this study was to evaluate the effects of cataracts on the flicker electroretinograms (ERGs) recorded with the RETeval™ system under mydriatic-free conditions. METHODS: This was a retrospective study of 82 eyes of 60 patients with cataracts and 52 eyes of 38 patients who were pseudophakic. Flicker ERGs were recorded with the RETeval™ system (LKC Technologies, Gaithersburg, MD) under mydriatic-free condition with skin electrodes. Flicker ERGs were elicited by white light delivered at a frequency of 28.3 Hz and intensity of 8 Td-s. The implicit times and amplitudes of the ERGs recorded from the Grade 2 cataract, Grade 3 cataract, and pseudophakic groups were compared. RESULTS: The mean amplitude was significantly smaller in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P < 0.0001; Grade 3 cataract vs pseudophakic group, P < 0.0001; Grade 2 cataract vs Grade 3 cataract, P = 0.027). The mean implicit times was significantly longer in both cataract groups than the pseudophakic group (Grade 2 cataract vs pseudophakic group, P = 0.046; Grade 3 cataract vs pseudophakic group, P = 0.0004; Grade 2 cataract vs Grade 3 cataract, P = 0.0084). CONCLUSIONS: The results indicate that the presence of Grade 2 or more cataracts will affect both the amplitude and the implicit time of the flicker ERGs. The presence of cataracts should be taken into consideration when interpreting the flicker ERG recorded with RETeval™. BioMed Central 2016-03-05 /pmc/articles/PMC4779227/ /pubmed/26944722 http://dx.doi.org/10.1186/s12886-016-0200-x Text en © Miura et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Miura, Gen Nakamura, Yosuke Sato, Eiju Yamamoto, Shuichi Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title | Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title_full | Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title_fullStr | Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title_full_unstemmed | Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title_short | Effects of cataracts on flicker electroretinograms recorded with RETeval™ system: new mydriasis-free ERG device |
title_sort | effects of cataracts on flicker electroretinograms recorded with reteval™ system: new mydriasis-free erg device |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4779227/ https://www.ncbi.nlm.nih.gov/pubmed/26944722 http://dx.doi.org/10.1186/s12886-016-0200-x |
work_keys_str_mv | AT miuragen effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice AT nakamurayosuke effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice AT satoeiju effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice AT yamamotoshuichi effectsofcataractsonflickerelectroretinogramsrecordedwithretevalsystemnewmydriasisfreeergdevice |