Cargando…

Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy

PURPOSE: We evaluated the characteristics of patients with Kawasaki disease (KD) who presented with only fever and cervical lymphadenopathy on admission, and compared them with the characteristics of those who presented with typical features but no cervical lymphadenopathy. METHODS: We enrolled 98 p...

Descripción completa

Detalles Bibliográficos
Autores principales: Kim, Jung Ok, Kim, Yeo Hyang, Hyun, Myung Chul
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Pediatric Society 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4781732/
https://www.ncbi.nlm.nih.gov/pubmed/26958063
http://dx.doi.org/10.3345/kjp.2016.59.2.54
_version_ 1782419827877478400
author Kim, Jung Ok
Kim, Yeo Hyang
Hyun, Myung Chul
author_facet Kim, Jung Ok
Kim, Yeo Hyang
Hyun, Myung Chul
author_sort Kim, Jung Ok
collection PubMed
description PURPOSE: We evaluated the characteristics of patients with Kawasaki disease (KD) who presented with only fever and cervical lymphadenopathy on admission, and compared them with the characteristics of those who presented with typical features but no cervical lymphadenopathy. METHODS: We enrolled 98 patients diagnosed with KD. Thirteen patients had only fever and cervical lymphadenopathy on the day of admission (group 1), 31 had typical features with cervical lymphadenopathy (group 2), and 54 had typical features without cervical lymphadenopathy (group 3). RESULTS: The mean age (4.3±2.1 years) and duration of fever (7.5±3.6 days) before the first intravenous immunoglobulin (IVIG) administration were highest in group 1 (P=0.001). Moreover, this group showed higher white blood cell and neutrophil counts, and lower lymphocyte counts after the first IVIG administration as compared to the other groups (P=0.001, P=0.001, and P=0.003, respectively). Group 1 also had a longer duration of hospitalization and higher frequency of second-line treatment as compared to groups 2 and 3 (group 1 vs. group 2, P=0.000 and P=0.024; group 1 vs. group 3, P=0.000 and P=0.007). A coronary artery z score of >2.5 was frequently observed in group 1 than in group 3 (P=0.008). CONCLUSION: KD should be suspected in children who are unresponsive to antibiotics and have prolonged fever and cervical lymphadenopathy, which indicates that KD is associated with the likelihood of requiring second-line treatment and risk of developing coronary artery dilatation.
format Online
Article
Text
id pubmed-4781732
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher The Korean Pediatric Society
record_format MEDLINE/PubMed
spelling pubmed-47817322016-03-08 Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy Kim, Jung Ok Kim, Yeo Hyang Hyun, Myung Chul Korean J Pediatr Original Article PURPOSE: We evaluated the characteristics of patients with Kawasaki disease (KD) who presented with only fever and cervical lymphadenopathy on admission, and compared them with the characteristics of those who presented with typical features but no cervical lymphadenopathy. METHODS: We enrolled 98 patients diagnosed with KD. Thirteen patients had only fever and cervical lymphadenopathy on the day of admission (group 1), 31 had typical features with cervical lymphadenopathy (group 2), and 54 had typical features without cervical lymphadenopathy (group 3). RESULTS: The mean age (4.3±2.1 years) and duration of fever (7.5±3.6 days) before the first intravenous immunoglobulin (IVIG) administration were highest in group 1 (P=0.001). Moreover, this group showed higher white blood cell and neutrophil counts, and lower lymphocyte counts after the first IVIG administration as compared to the other groups (P=0.001, P=0.001, and P=0.003, respectively). Group 1 also had a longer duration of hospitalization and higher frequency of second-line treatment as compared to groups 2 and 3 (group 1 vs. group 2, P=0.000 and P=0.024; group 1 vs. group 3, P=0.000 and P=0.007). A coronary artery z score of >2.5 was frequently observed in group 1 than in group 3 (P=0.008). CONCLUSION: KD should be suspected in children who are unresponsive to antibiotics and have prolonged fever and cervical lymphadenopathy, which indicates that KD is associated with the likelihood of requiring second-line treatment and risk of developing coronary artery dilatation. The Korean Pediatric Society 2016-02 2016-02-29 /pmc/articles/PMC4781732/ /pubmed/26958063 http://dx.doi.org/10.3345/kjp.2016.59.2.54 Text en Copyright © 2016 by The Korean Pediatric Society http://creativecommons.org/licenses/by-nc/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Kim, Jung Ok
Kim, Yeo Hyang
Hyun, Myung Chul
Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title_full Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title_fullStr Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title_full_unstemmed Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title_short Comparison between Kawasaki disease with lymph-node-first presentation and Kawasaki disease without cervical lymphadenopathy
title_sort comparison between kawasaki disease with lymph-node-first presentation and kawasaki disease without cervical lymphadenopathy
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4781732/
https://www.ncbi.nlm.nih.gov/pubmed/26958063
http://dx.doi.org/10.3345/kjp.2016.59.2.54
work_keys_str_mv AT kimjungok comparisonbetweenkawasakidiseasewithlymphnodefirstpresentationandkawasakidiseasewithoutcervicallymphadenopathy
AT kimyeohyang comparisonbetweenkawasakidiseasewithlymphnodefirstpresentationandkawasakidiseasewithoutcervicallymphadenopathy
AT hyunmyungchul comparisonbetweenkawasakidiseasewithlymphnodefirstpresentationandkawasakidiseasewithoutcervicallymphadenopathy