Cargando…
Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterizatio...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4788852/ https://www.ncbi.nlm.nih.gov/pubmed/26968160 http://dx.doi.org/10.1186/s13071-016-1423-7 |
_version_ | 1782420776503214080 |
---|---|
author | Yang, Jifei Tian, Zhancheng Liu, Zhijie Niu, Qingli Han, Rong Li, Youquan Guan, Guiquan Liu, Junlong Liu, Guangyuan Luo, Jianxun Yin, Hong |
author_facet | Yang, Jifei Tian, Zhancheng Liu, Zhijie Niu, Qingli Han, Rong Li, Youquan Guan, Guiquan Liu, Junlong Liu, Guangyuan Luo, Jianxun Yin, Hong |
author_sort | Yang, Jifei |
collection | PubMed |
description | BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterization of Rickettsia spp. in ticks collected from Gansu, where Borrelia burgdorferi sensu lato and Anaplasma phagocytophilum were previously reported in ticks and ruminants. METHODS: A total of 1,583 questing Haemaphysalis qinghaiensis ticks were collected and tested for the presence of Rickettsia spp. gltA gene by PCR. Samples positive for gltA were examined by specific primers targeted for the ompA gene of SFG rickettsiae. The infections were further validated by sequencing and positive samples were genetically characterized based on the gltA and ompA genes. RESULTS: In total, Rickettsia spp. infection was found in 179 (18.5 %) H. qinghaiensis tick pools by using PCR and primers specific for the gltA gene. Of those, 157 (16.3 %) tick pools were positive for SFG rickettsiae by PCR based on ompA gene. Amplification and molecular analysis of the nucleotide sequences of gltA and ompA genes indicated three potential novel spotted fever group rickettsiae in H. qinghaiensis ticks. These three potential novel spotted fever group rickettsiae were clustered together in a subgroup, which represents a sister taxon to and separates from other known four SFG rickettsiae subgroups. CONCLUSIONS: This study revealed a high infection rate of SFG rickettsiae in H. qinghaiensis ticks in northwest China. Three potential novel spotted fever group rickettsiae classified into a novel SFG rickettsiae subgroup were identified and named “Candidatus Rickettsia gannanii” related strains in recognition of the location where it was first detected. |
format | Online Article Text |
id | pubmed-4788852 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-47888522016-03-13 Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China Yang, Jifei Tian, Zhancheng Liu, Zhijie Niu, Qingli Han, Rong Li, Youquan Guan, Guiquan Liu, Junlong Liu, Guangyuan Luo, Jianxun Yin, Hong Parasit Vectors Research BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterization of Rickettsia spp. in ticks collected from Gansu, where Borrelia burgdorferi sensu lato and Anaplasma phagocytophilum were previously reported in ticks and ruminants. METHODS: A total of 1,583 questing Haemaphysalis qinghaiensis ticks were collected and tested for the presence of Rickettsia spp. gltA gene by PCR. Samples positive for gltA were examined by specific primers targeted for the ompA gene of SFG rickettsiae. The infections were further validated by sequencing and positive samples were genetically characterized based on the gltA and ompA genes. RESULTS: In total, Rickettsia spp. infection was found in 179 (18.5 %) H. qinghaiensis tick pools by using PCR and primers specific for the gltA gene. Of those, 157 (16.3 %) tick pools were positive for SFG rickettsiae by PCR based on ompA gene. Amplification and molecular analysis of the nucleotide sequences of gltA and ompA genes indicated three potential novel spotted fever group rickettsiae in H. qinghaiensis ticks. These three potential novel spotted fever group rickettsiae were clustered together in a subgroup, which represents a sister taxon to and separates from other known four SFG rickettsiae subgroups. CONCLUSIONS: This study revealed a high infection rate of SFG rickettsiae in H. qinghaiensis ticks in northwest China. Three potential novel spotted fever group rickettsiae classified into a novel SFG rickettsiae subgroup were identified and named “Candidatus Rickettsia gannanii” related strains in recognition of the location where it was first detected. BioMed Central 2016-03-12 /pmc/articles/PMC4788852/ /pubmed/26968160 http://dx.doi.org/10.1186/s13071-016-1423-7 Text en © Yang et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Yang, Jifei Tian, Zhancheng Liu, Zhijie Niu, Qingli Han, Rong Li, Youquan Guan, Guiquan Liu, Junlong Liu, Guangyuan Luo, Jianxun Yin, Hong Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title | Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title_full | Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title_fullStr | Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title_full_unstemmed | Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title_short | Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China |
title_sort | novel spotted fever group rickettsiae in haemaphysalis qinghaiensis ticks from gansu, northwest china |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4788852/ https://www.ncbi.nlm.nih.gov/pubmed/26968160 http://dx.doi.org/10.1186/s13071-016-1423-7 |
work_keys_str_mv | AT yangjifei novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT tianzhancheng novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT liuzhijie novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT niuqingli novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT hanrong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT liyouquan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT guanguiquan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT liujunlong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT liuguangyuan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT luojianxun novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina AT yinhong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina |