Cargando…

Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China

BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterizatio...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Jifei, Tian, Zhancheng, Liu, Zhijie, Niu, Qingli, Han, Rong, Li, Youquan, Guan, Guiquan, Liu, Junlong, Liu, Guangyuan, Luo, Jianxun, Yin, Hong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4788852/
https://www.ncbi.nlm.nih.gov/pubmed/26968160
http://dx.doi.org/10.1186/s13071-016-1423-7
_version_ 1782420776503214080
author Yang, Jifei
Tian, Zhancheng
Liu, Zhijie
Niu, Qingli
Han, Rong
Li, Youquan
Guan, Guiquan
Liu, Junlong
Liu, Guangyuan
Luo, Jianxun
Yin, Hong
author_facet Yang, Jifei
Tian, Zhancheng
Liu, Zhijie
Niu, Qingli
Han, Rong
Li, Youquan
Guan, Guiquan
Liu, Junlong
Liu, Guangyuan
Luo, Jianxun
Yin, Hong
author_sort Yang, Jifei
collection PubMed
description BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterization of Rickettsia spp. in ticks collected from Gansu, where Borrelia burgdorferi sensu lato and Anaplasma phagocytophilum were previously reported in ticks and ruminants. METHODS: A total of 1,583 questing Haemaphysalis qinghaiensis ticks were collected and tested for the presence of Rickettsia spp. gltA gene by PCR. Samples positive for gltA were examined by specific primers targeted for the ompA gene of SFG rickettsiae. The infections were further validated by sequencing and positive samples were genetically characterized based on the gltA and ompA genes. RESULTS: In total, Rickettsia spp. infection was found in 179 (18.5 %) H. qinghaiensis tick pools by using PCR and primers specific for the gltA gene. Of those, 157 (16.3 %) tick pools were positive for SFG rickettsiae by PCR based on ompA gene. Amplification and molecular analysis of the nucleotide sequences of gltA and ompA genes indicated three potential novel spotted fever group rickettsiae in H. qinghaiensis ticks. These three potential novel spotted fever group rickettsiae were clustered together in a subgroup, which represents a sister taxon to and separates from other known four SFG rickettsiae subgroups. CONCLUSIONS: This study revealed a high infection rate of SFG rickettsiae in H. qinghaiensis ticks in northwest China. Three potential novel spotted fever group rickettsiae classified into a novel SFG rickettsiae subgroup were identified and named “Candidatus Rickettsia gannanii” related strains in recognition of the location where it was first detected.
format Online
Article
Text
id pubmed-4788852
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-47888522016-03-13 Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China Yang, Jifei Tian, Zhancheng Liu, Zhijie Niu, Qingli Han, Rong Li, Youquan Guan, Guiquan Liu, Junlong Liu, Guangyuan Luo, Jianxun Yin, Hong Parasit Vectors Research BACKGROUND: Rickettsia spp. are obligate intracellular bacteria and well known as transmitted by arthropods. These pathogens have a broad geographic distribution and a high degree of biological and clinical diversity. This study was conducted to determine the prevalence and molecular characterization of Rickettsia spp. in ticks collected from Gansu, where Borrelia burgdorferi sensu lato and Anaplasma phagocytophilum were previously reported in ticks and ruminants. METHODS: A total of 1,583 questing Haemaphysalis qinghaiensis ticks were collected and tested for the presence of Rickettsia spp. gltA gene by PCR. Samples positive for gltA were examined by specific primers targeted for the ompA gene of SFG rickettsiae. The infections were further validated by sequencing and positive samples were genetically characterized based on the gltA and ompA genes. RESULTS: In total, Rickettsia spp. infection was found in 179 (18.5 %) H. qinghaiensis tick pools by using PCR and primers specific for the gltA gene. Of those, 157 (16.3 %) tick pools were positive for SFG rickettsiae by PCR based on ompA gene. Amplification and molecular analysis of the nucleotide sequences of gltA and ompA genes indicated three potential novel spotted fever group rickettsiae in H. qinghaiensis ticks. These three potential novel spotted fever group rickettsiae were clustered together in a subgroup, which represents a sister taxon to and separates from other known four SFG rickettsiae subgroups. CONCLUSIONS: This study revealed a high infection rate of SFG rickettsiae in H. qinghaiensis ticks in northwest China. Three potential novel spotted fever group rickettsiae classified into a novel SFG rickettsiae subgroup were identified and named “Candidatus Rickettsia gannanii” related strains in recognition of the location where it was first detected. BioMed Central 2016-03-12 /pmc/articles/PMC4788852/ /pubmed/26968160 http://dx.doi.org/10.1186/s13071-016-1423-7 Text en © Yang et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Yang, Jifei
Tian, Zhancheng
Liu, Zhijie
Niu, Qingli
Han, Rong
Li, Youquan
Guan, Guiquan
Liu, Junlong
Liu, Guangyuan
Luo, Jianxun
Yin, Hong
Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title_full Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title_fullStr Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title_full_unstemmed Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title_short Novel spotted fever group rickettsiae in Haemaphysalis qinghaiensis ticks from Gansu, Northwest China
title_sort novel spotted fever group rickettsiae in haemaphysalis qinghaiensis ticks from gansu, northwest china
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4788852/
https://www.ncbi.nlm.nih.gov/pubmed/26968160
http://dx.doi.org/10.1186/s13071-016-1423-7
work_keys_str_mv AT yangjifei novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT tianzhancheng novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT liuzhijie novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT niuqingli novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT hanrong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT liyouquan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT guanguiquan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT liujunlong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT liuguangyuan novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT luojianxun novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina
AT yinhong novelspottedfevergrouprickettsiaeinhaemaphysalisqinghaiensisticksfromgansunorthwestchina