Cargando…
Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015
The editors of Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine would like to thank all our reviewers who have contributed to the journal in volume 23 (2015).
| Autor principal: | |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2016
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4797245/ http://dx.doi.org/10.1186/s13049-016-0223-6 |
| _version_ | 1782421918487412736 |
|---|---|
| author | Bache, Kristi G. |
| author_facet | Bache, Kristi G. |
| author_sort | Bache, Kristi G. |
| collection | PubMed |
| description | The editors of Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine would like to thank all our reviewers who have contributed to the journal in volume 23 (2015). |
| format | Online Article Text |
| id | pubmed-4797245 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2016 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-47972452016-03-19 Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 Bache, Kristi G. Scand J Trauma Resusc Emerg Med Reviewer Acknowledgement The editors of Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine would like to thank all our reviewers who have contributed to the journal in volume 23 (2015). BioMed Central 2016-03-17 /pmc/articles/PMC4797245/ http://dx.doi.org/10.1186/s13049-016-0223-6 Text en © Bache. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Reviewer Acknowledgement Bache, Kristi G. Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title | Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title_full | Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title_fullStr | Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title_full_unstemmed | Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title_short | Scandinavian Journal of Trauma, Resuscitation and Emergency Medicine reviewer acknowledgement 2015 |
| title_sort | scandinavian journal of trauma, resuscitation and emergency medicine reviewer acknowledgement 2015 |
| topic | Reviewer Acknowledgement |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4797245/ http://dx.doi.org/10.1186/s13049-016-0223-6 |
| work_keys_str_mv | AT bachekristig scandinavianjournaloftraumaresuscitationandemergencymedicinerevieweracknowledgement2015 |