Cargando…
Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent
The prolyl hydroxylase inhibitor dimethyloxallyl glycine (DMOG) has been increasingly studied with regards to stem cell therapy. Previous studies have demonstrated that endogenous mesenchymal stem cells (MSCs) may be mobilized into peripheral circulation by pharmaceutical preconditioning. In additio...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
D.A. Spandidos
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4805059/ https://www.ncbi.nlm.nih.gov/pubmed/26935134 http://dx.doi.org/10.3892/mmr.2016.4945 |
_version_ | 1782423083977539584 |
---|---|
author | GE, TINGTING YU, QIN LIU, WEI CONG, LI LIU, LIZHEN WANG, YAN ZHOU, LIPING LIN, DEJU |
author_facet | GE, TINGTING YU, QIN LIU, WEI CONG, LI LIU, LIZHEN WANG, YAN ZHOU, LIPING LIN, DEJU |
author_sort | GE, TINGTING |
collection | PubMed |
description | The prolyl hydroxylase inhibitor dimethyloxallyl glycine (DMOG) has been increasingly studied with regards to stem cell therapy. Previous studies have demonstrated that endogenous mesenchymal stem cells (MSCs) may be mobilized into peripheral circulation by pharmaceutical preconditioning. In addition, our previous study confirmed that DMOG, as a novel mobilization agent, could induce mouse/rat MSC migration into peripheral blood circulation. Therefore, the present study conducted studies to characterize bone marrow-derived MSCs (BM-MSCs) collected from mice following DMOG intraperitoneal injection. The surface antigen immune phenotype, differentiation capability, proliferative ability, migratory capacity and paracrine capacity of the BM-MSCs collected from DMOG-preconditioned mice (DBM-MSCs) or normal saline-treated mice (NBM-MSCs) were evaluated by means of flow cytometry, differentiation induction, Cell Counting kit-8, Transwell assay and enzyme-linked immunosorbent assay, respectively. Compared with NBM-MSCs, DBM-MSCs displayed a similar immune phenotype and multilineage differentiation capability, reduced proliferative ability and migratory capacity, and similar transforming growth factor and platelet-derived growth factor secretion capacity. These results provide a novel insight into the biological properties of BM-MSCs from mice preconditioned with DMOG. DBM-MSCs exhibited slightly distinct characteristics to NBM-MSCs; however, they may have therapeutic potential for future stem cell therapy. In addition, the present study suggested that DMOG may be used as a novel mobilization agent in future clinical trials as no adverse effects were observed. |
format | Online Article Text |
id | pubmed-4805059 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | D.A. Spandidos |
record_format | MEDLINE/PubMed |
spelling | pubmed-48050592016-04-04 Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent GE, TINGTING YU, QIN LIU, WEI CONG, LI LIU, LIZHEN WANG, YAN ZHOU, LIPING LIN, DEJU Mol Med Rep Articles The prolyl hydroxylase inhibitor dimethyloxallyl glycine (DMOG) has been increasingly studied with regards to stem cell therapy. Previous studies have demonstrated that endogenous mesenchymal stem cells (MSCs) may be mobilized into peripheral circulation by pharmaceutical preconditioning. In addition, our previous study confirmed that DMOG, as a novel mobilization agent, could induce mouse/rat MSC migration into peripheral blood circulation. Therefore, the present study conducted studies to characterize bone marrow-derived MSCs (BM-MSCs) collected from mice following DMOG intraperitoneal injection. The surface antigen immune phenotype, differentiation capability, proliferative ability, migratory capacity and paracrine capacity of the BM-MSCs collected from DMOG-preconditioned mice (DBM-MSCs) or normal saline-treated mice (NBM-MSCs) were evaluated by means of flow cytometry, differentiation induction, Cell Counting kit-8, Transwell assay and enzyme-linked immunosorbent assay, respectively. Compared with NBM-MSCs, DBM-MSCs displayed a similar immune phenotype and multilineage differentiation capability, reduced proliferative ability and migratory capacity, and similar transforming growth factor and platelet-derived growth factor secretion capacity. These results provide a novel insight into the biological properties of BM-MSCs from mice preconditioned with DMOG. DBM-MSCs exhibited slightly distinct characteristics to NBM-MSCs; however, they may have therapeutic potential for future stem cell therapy. In addition, the present study suggested that DMOG may be used as a novel mobilization agent in future clinical trials as no adverse effects were observed. D.A. Spandidos 2016-04 2016-02-29 /pmc/articles/PMC4805059/ /pubmed/26935134 http://dx.doi.org/10.3892/mmr.2016.4945 Text en Copyright: © Ge et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made. |
spellingShingle | Articles GE, TINGTING YU, QIN LIU, WEI CONG, LI LIU, LIZHEN WANG, YAN ZHOU, LIPING LIN, DEJU Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title | Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title_full | Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title_fullStr | Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title_full_unstemmed | Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title_short | Characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: Evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
title_sort | characterization of bone marrow-derived mesenchymal stem cells from dimethyloxallyl glycine-preconditioned mice: evaluation of the feasibility of dimethyloxallyl glycine as a mobilization agent |
topic | Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4805059/ https://www.ncbi.nlm.nih.gov/pubmed/26935134 http://dx.doi.org/10.3892/mmr.2016.4945 |
work_keys_str_mv | AT getingting characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT yuqin characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT liuwei characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT congli characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT liulizhen characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT wangyan characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT zhouliping characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent AT lindeju characterizationofbonemarrowderivedmesenchymalstemcellsfromdimethyloxallylglycinepreconditionedmiceevaluationofthefeasibilityofdimethyloxallylglycineasamobilizationagent |