Cargando…

Q fever is an old and neglected zoonotic disease in Kenya: a systematic review

BACKGROUND: Q fever is a neglected zoonosis caused by the bacterium Coxiella burnetii. The knowledge of the epidemiology of Q fever in Kenya is limited with no attention to control and prevention programs. The purpose of this review is to understand the situation of Q fever in human and animal popul...

Descripción completa

Detalles Bibliográficos
Autores principales: Njeru, J., Henning, K., Pletz, M. W., Heller, R., Neubauer, H.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4822290/
https://www.ncbi.nlm.nih.gov/pubmed/27048480
http://dx.doi.org/10.1186/s12889-016-2929-9
_version_ 1782425756325904384
author Njeru, J.
Henning, K.
Pletz, M. W.
Heller, R.
Neubauer, H.
author_facet Njeru, J.
Henning, K.
Pletz, M. W.
Heller, R.
Neubauer, H.
author_sort Njeru, J.
collection PubMed
description BACKGROUND: Q fever is a neglected zoonosis caused by the bacterium Coxiella burnetii. The knowledge of the epidemiology of Q fever in Kenya is limited with no attention to control and prevention programs. The purpose of this review is to understand the situation of Q fever in human and animal populations in Kenya in the past 60 years, and help identify future research priorities for the country. METHODS: Databases were searched for national and international scientific studies or reports on Q fever. We included studies and reports published between 1950 and 2015 if they reported on Q fever prevalence, incidence, and infection control programs in Kenya. Data were extracted with respect to studies on prevalence of Coxiella infections, study design, study region, the study populations involved, and sorted according to the year of the study. RESULTS: We identified 15 studies and reports which qualified for data extraction. Human seroprevalence studies revealed evidence of C. burnetii infections ranging from 3 to 35.8 % in all regions in which surveys were made and two Q fever outbreak episodes. Coxiella burnetii infections found in cattle 7.4–51.1 %, sheep 6.7–20 %, camels 20–46 %, and goats 20–46 % revealed variation based on ecoregions and the year of study. Farming and lack of protective clothing were associated with increased seropositivity among humans. However, high quality data is lacking on Q fever awareness, underlying cultural-economic factors influencing C. burnetii infection, and how the pathogen cycles may be embedded in livestock production and management systems in the economically and ecologically different Kenyan regions. We found no studies on national disease incidence estimates or disease surveillance and control efforts. CONCLUSION: Coxiella burnetii infections are common in human and in a wide range of animal populations but are still unrecognized and underestimated thus presenting a significant human and animal health threat in Kenya. The factors influencing pathogen transmission, persistence and spread are poorly understood. Integrated disease surveillance and prevention/control programs are needed in Kenya.
format Online
Article
Text
id pubmed-4822290
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-48222902016-04-07 Q fever is an old and neglected zoonotic disease in Kenya: a systematic review Njeru, J. Henning, K. Pletz, M. W. Heller, R. Neubauer, H. BMC Public Health Research Article BACKGROUND: Q fever is a neglected zoonosis caused by the bacterium Coxiella burnetii. The knowledge of the epidemiology of Q fever in Kenya is limited with no attention to control and prevention programs. The purpose of this review is to understand the situation of Q fever in human and animal populations in Kenya in the past 60 years, and help identify future research priorities for the country. METHODS: Databases were searched for national and international scientific studies or reports on Q fever. We included studies and reports published between 1950 and 2015 if they reported on Q fever prevalence, incidence, and infection control programs in Kenya. Data were extracted with respect to studies on prevalence of Coxiella infections, study design, study region, the study populations involved, and sorted according to the year of the study. RESULTS: We identified 15 studies and reports which qualified for data extraction. Human seroprevalence studies revealed evidence of C. burnetii infections ranging from 3 to 35.8 % in all regions in which surveys were made and two Q fever outbreak episodes. Coxiella burnetii infections found in cattle 7.4–51.1 %, sheep 6.7–20 %, camels 20–46 %, and goats 20–46 % revealed variation based on ecoregions and the year of study. Farming and lack of protective clothing were associated with increased seropositivity among humans. However, high quality data is lacking on Q fever awareness, underlying cultural-economic factors influencing C. burnetii infection, and how the pathogen cycles may be embedded in livestock production and management systems in the economically and ecologically different Kenyan regions. We found no studies on national disease incidence estimates or disease surveillance and control efforts. CONCLUSION: Coxiella burnetii infections are common in human and in a wide range of animal populations but are still unrecognized and underestimated thus presenting a significant human and animal health threat in Kenya. The factors influencing pathogen transmission, persistence and spread are poorly understood. Integrated disease surveillance and prevention/control programs are needed in Kenya. BioMed Central 2016-04-05 /pmc/articles/PMC4822290/ /pubmed/27048480 http://dx.doi.org/10.1186/s12889-016-2929-9 Text en © Njeru et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Njeru, J.
Henning, K.
Pletz, M. W.
Heller, R.
Neubauer, H.
Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title_full Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title_fullStr Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title_full_unstemmed Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title_short Q fever is an old and neglected zoonotic disease in Kenya: a systematic review
title_sort q fever is an old and neglected zoonotic disease in kenya: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4822290/
https://www.ncbi.nlm.nih.gov/pubmed/27048480
http://dx.doi.org/10.1186/s12889-016-2929-9
work_keys_str_mv AT njeruj qfeverisanoldandneglectedzoonoticdiseaseinkenyaasystematicreview
AT henningk qfeverisanoldandneglectedzoonoticdiseaseinkenyaasystematicreview
AT pletzmw qfeverisanoldandneglectedzoonoticdiseaseinkenyaasystematicreview
AT hellerr qfeverisanoldandneglectedzoonoticdiseaseinkenyaasystematicreview
AT neubauerh qfeverisanoldandneglectedzoonoticdiseaseinkenyaasystematicreview