Cargando…
Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastr...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4826170/ https://www.ncbi.nlm.nih.gov/pubmed/26565812 http://dx.doi.org/10.18632/oncotarget.6302 |
_version_ | 1782426296528142336 |
---|---|
author | Wang, Lan Ouyang, Fei Liu, Xiaobo Wu, Shu Wu, Hong-mei Xu, Yuandong Wang, Bin Zhu, Jinrong Xu, Xuehu Zhang, Liang |
author_facet | Wang, Lan Ouyang, Fei Liu, Xiaobo Wu, Shu Wu, Hong-mei Xu, Yuandong Wang, Bin Zhu, Jinrong Xu, Xuehu Zhang, Liang |
author_sort | Wang, Lan |
collection | PubMed |
description | CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastric cancer cells compared to normal gastric epithelial cells (P < 0.001). Immunohistochemical analysis of 261 paraffin-embedded archived gastric cancer tissues showed that high CISD2 expression was significantly associated with clinical stage, TNM classifications, venous invasion and lymphatic invasion. Univariate and multivariate analysis indicated that high CISD2 expression was an independent prognostic factor for poorer overall survival in the entire cohort. Overexpressing CISD2 promoted, while silencing CISD2 inhibited, the proliferation of gastric cancer cells. Furthermore, we found that silencing endogenous CISD2 also significantly inhibited the proliferation and tumorigenicity of MGC-803 and SGC-7901 cells not only in vitro but also in vivo in NOD/SCID mice (P < 0.05). Furthermore, we found that CISD2 affected cell proliferation and tumorigenicity of gastric cancer cells through mediating the G1-to-S phase transition. Moreover, we demonstrated that the pro-proliferative effect of CISD2 on gastric cancer cells was associated with downregulation of cyclin-dependent kinase inhibitor p21Cip1 and p27Kip1, and activation of AKT signaling. The findings of this study indicate that CISD2 may promote proliferation and tumorigenicity, potentially representing a novel prognostic marker for overall survival in gastric cancer. |
format | Online Article Text |
id | pubmed-4826170 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-48261702016-05-09 Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway Wang, Lan Ouyang, Fei Liu, Xiaobo Wu, Shu Wu, Hong-mei Xu, Yuandong Wang, Bin Zhu, Jinrong Xu, Xuehu Zhang, Liang Oncotarget Research Paper CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastric cancer cells compared to normal gastric epithelial cells (P < 0.001). Immunohistochemical analysis of 261 paraffin-embedded archived gastric cancer tissues showed that high CISD2 expression was significantly associated with clinical stage, TNM classifications, venous invasion and lymphatic invasion. Univariate and multivariate analysis indicated that high CISD2 expression was an independent prognostic factor for poorer overall survival in the entire cohort. Overexpressing CISD2 promoted, while silencing CISD2 inhibited, the proliferation of gastric cancer cells. Furthermore, we found that silencing endogenous CISD2 also significantly inhibited the proliferation and tumorigenicity of MGC-803 and SGC-7901 cells not only in vitro but also in vivo in NOD/SCID mice (P < 0.05). Furthermore, we found that CISD2 affected cell proliferation and tumorigenicity of gastric cancer cells through mediating the G1-to-S phase transition. Moreover, we demonstrated that the pro-proliferative effect of CISD2 on gastric cancer cells was associated with downregulation of cyclin-dependent kinase inhibitor p21Cip1 and p27Kip1, and activation of AKT signaling. The findings of this study indicate that CISD2 may promote proliferation and tumorigenicity, potentially representing a novel prognostic marker for overall survival in gastric cancer. Impact Journals LLC 2015-11-10 /pmc/articles/PMC4826170/ /pubmed/26565812 http://dx.doi.org/10.18632/oncotarget.6302 Text en Copyright: © 2016 Wang et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Wang, Lan Ouyang, Fei Liu, Xiaobo Wu, Shu Wu, Hong-mei Xu, Yuandong Wang, Bin Zhu, Jinrong Xu, Xuehu Zhang, Liang Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title | Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title_full | Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title_fullStr | Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title_full_unstemmed | Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title_short | Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway |
title_sort | overexpressed cisd2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via akt signaling pathway |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4826170/ https://www.ncbi.nlm.nih.gov/pubmed/26565812 http://dx.doi.org/10.18632/oncotarget.6302 |
work_keys_str_mv | AT wanglan overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT ouyangfei overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT liuxiaobo overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT wushu overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT wuhongmei overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT xuyuandong overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT wangbin overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT zhujinrong overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT xuxuehu overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway AT zhangliang overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway |