Cargando…

Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway

CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastr...

Descripción completa

Detalles Bibliográficos
Autores principales: Wang, Lan, Ouyang, Fei, Liu, Xiaobo, Wu, Shu, Wu, Hong-mei, Xu, Yuandong, Wang, Bin, Zhu, Jinrong, Xu, Xuehu, Zhang, Liang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4826170/
https://www.ncbi.nlm.nih.gov/pubmed/26565812
http://dx.doi.org/10.18632/oncotarget.6302
_version_ 1782426296528142336
author Wang, Lan
Ouyang, Fei
Liu, Xiaobo
Wu, Shu
Wu, Hong-mei
Xu, Yuandong
Wang, Bin
Zhu, Jinrong
Xu, Xuehu
Zhang, Liang
author_facet Wang, Lan
Ouyang, Fei
Liu, Xiaobo
Wu, Shu
Wu, Hong-mei
Xu, Yuandong
Wang, Bin
Zhu, Jinrong
Xu, Xuehu
Zhang, Liang
author_sort Wang, Lan
collection PubMed
description CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastric cancer cells compared to normal gastric epithelial cells (P < 0.001). Immunohistochemical analysis of 261 paraffin-embedded archived gastric cancer tissues showed that high CISD2 expression was significantly associated with clinical stage, TNM classifications, venous invasion and lymphatic invasion. Univariate and multivariate analysis indicated that high CISD2 expression was an independent prognostic factor for poorer overall survival in the entire cohort. Overexpressing CISD2 promoted, while silencing CISD2 inhibited, the proliferation of gastric cancer cells. Furthermore, we found that silencing endogenous CISD2 also significantly inhibited the proliferation and tumorigenicity of MGC-803 and SGC-7901 cells not only in vitro but also in vivo in NOD/SCID mice (P < 0.05). Furthermore, we found that CISD2 affected cell proliferation and tumorigenicity of gastric cancer cells through mediating the G1-to-S phase transition. Moreover, we demonstrated that the pro-proliferative effect of CISD2 on gastric cancer cells was associated with downregulation of cyclin-dependent kinase inhibitor p21Cip1 and p27Kip1, and activation of AKT signaling. The findings of this study indicate that CISD2 may promote proliferation and tumorigenicity, potentially representing a novel prognostic marker for overall survival in gastric cancer.
format Online
Article
Text
id pubmed-4826170
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-48261702016-05-09 Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway Wang, Lan Ouyang, Fei Liu, Xiaobo Wu, Shu Wu, Hong-mei Xu, Yuandong Wang, Bin Zhu, Jinrong Xu, Xuehu Zhang, Liang Oncotarget Research Paper CDGSH iron sulfur domain 2 (CISD2) is localized in the outer mitochondrial membrane and mediates mitochondrial integrity and lifespan in mammals, but its role in cancer is unknown. In the current study, we reported that CISD2 mRNA and protein expression levels were significantly upregulated in gastric cancer cells compared to normal gastric epithelial cells (P < 0.001). Immunohistochemical analysis of 261 paraffin-embedded archived gastric cancer tissues showed that high CISD2 expression was significantly associated with clinical stage, TNM classifications, venous invasion and lymphatic invasion. Univariate and multivariate analysis indicated that high CISD2 expression was an independent prognostic factor for poorer overall survival in the entire cohort. Overexpressing CISD2 promoted, while silencing CISD2 inhibited, the proliferation of gastric cancer cells. Furthermore, we found that silencing endogenous CISD2 also significantly inhibited the proliferation and tumorigenicity of MGC-803 and SGC-7901 cells not only in vitro but also in vivo in NOD/SCID mice (P < 0.05). Furthermore, we found that CISD2 affected cell proliferation and tumorigenicity of gastric cancer cells through mediating the G1-to-S phase transition. Moreover, we demonstrated that the pro-proliferative effect of CISD2 on gastric cancer cells was associated with downregulation of cyclin-dependent kinase inhibitor p21Cip1 and p27Kip1, and activation of AKT signaling. The findings of this study indicate that CISD2 may promote proliferation and tumorigenicity, potentially representing a novel prognostic marker for overall survival in gastric cancer. Impact Journals LLC 2015-11-10 /pmc/articles/PMC4826170/ /pubmed/26565812 http://dx.doi.org/10.18632/oncotarget.6302 Text en Copyright: © 2016 Wang et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Paper
Wang, Lan
Ouyang, Fei
Liu, Xiaobo
Wu, Shu
Wu, Hong-mei
Xu, Yuandong
Wang, Bin
Zhu, Jinrong
Xu, Xuehu
Zhang, Liang
Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title_full Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title_fullStr Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title_full_unstemmed Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title_short Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway
title_sort overexpressed cisd2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via akt signaling pathway
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4826170/
https://www.ncbi.nlm.nih.gov/pubmed/26565812
http://dx.doi.org/10.18632/oncotarget.6302
work_keys_str_mv AT wanglan overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT ouyangfei overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT liuxiaobo overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT wushu overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT wuhongmei overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT xuyuandong overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT wangbin overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT zhujinrong overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT xuxuehu overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway
AT zhangliang overexpressedcisd2hasprognosticvalueinhumangastriccancerandpromotesgastriccancercellproliferationandtumorigenesisviaaktsignalingpathway