Cargando…

Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid

OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease...

Descripción completa

Detalles Bibliográficos
Autores principales: Spengler, Julia, Lugonja, Božo, Jimmy Ytterberg, A., Zubarev, Roman A., Creese, Andrew J., Pearson, Mark J., Grant, Melissa M., Milward, Michael, Lundberg, Karin, Buckley, Christopher D., Filer, Andrew, Raza, Karim, Cooper, Paul R., Chapple, Iain L., Scheel‐Toellner, Dagmar
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4832324/
https://www.ncbi.nlm.nih.gov/pubmed/26245941
http://dx.doi.org/10.1002/art.39313
_version_ 1782427235166191616
author Spengler, Julia
Lugonja, Božo
Jimmy Ytterberg, A.
Zubarev, Roman A.
Creese, Andrew J.
Pearson, Mark J.
Grant, Melissa M.
Milward, Michael
Lundberg, Karin
Buckley, Christopher D.
Filer, Andrew
Raza, Karim
Cooper, Paul R.
Chapple, Iain L.
Scheel‐Toellner, Dagmar
author_facet Spengler, Julia
Lugonja, Božo
Jimmy Ytterberg, A.
Zubarev, Roman A.
Creese, Andrew J.
Pearson, Mark J.
Grant, Melissa M.
Milward, Michael
Lundberg, Karin
Buckley, Christopher D.
Filer, Andrew
Raza, Karim
Cooper, Paul R.
Chapple, Iain L.
Scheel‐Toellner, Dagmar
author_sort Spengler, Julia
collection PubMed
description OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease flares. This study was undertaken to test the hypothesis that neutrophil cell death, induced by either NETosis (extrusion of genomic DNA–protein complexes known as neutrophil extracellular traps [NETs]) or necrosis, can contribute to production of autoantigens in the inflamed joint. METHODS: Extracellular DNA was quantified in the SF of patients with RA, patients with osteoarthritis (OA), and patients with psoriatic arthritis (PsA). Release of PAD from neutrophils was investigated by Western blotting, mass spectrometry, immunofluorescence staining, and PAD activity assays. PAD2 and PAD4 protein expression, as well as PAD enzymatic activity, were assessed in the SF of patients with RA and those with OA. RESULTS: Extracellular DNA was detected at significantly higher levels in RA SF than in OA SF (P < 0.001) or PsA SF (P < 0.05), and its expression levels correlated with neutrophil concentrations and PAD activity in RA SF. Necrotic neutrophils released less soluble extracellular DNA compared to NETotic cells in vitro (P < 0.05). Higher PAD activity was detected in RA SF than in OA SF (P < 0.05). The citrullinated proteins PAD2 and PAD4 were found attached to NETs and also freely diffused in the supernatant. PAD enzymatic activity was detected in supernatants of neutrophils undergoing either NETosis or necrosis. CONCLUSION: Release of active PAD isoforms into the SF by neutrophil cell death is a plausible explanation for the generation of extracellular autoantigens in RA.
format Online
Article
Text
id pubmed-4832324
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-48323242016-06-24 Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid Spengler, Julia Lugonja, Božo Jimmy Ytterberg, A. Zubarev, Roman A. Creese, Andrew J. Pearson, Mark J. Grant, Melissa M. Milward, Michael Lundberg, Karin Buckley, Christopher D. Filer, Andrew Raza, Karim Cooper, Paul R. Chapple, Iain L. Scheel‐Toellner, Dagmar Arthritis Rheumatol Rheumatoid Arthritis OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease flares. This study was undertaken to test the hypothesis that neutrophil cell death, induced by either NETosis (extrusion of genomic DNA–protein complexes known as neutrophil extracellular traps [NETs]) or necrosis, can contribute to production of autoantigens in the inflamed joint. METHODS: Extracellular DNA was quantified in the SF of patients with RA, patients with osteoarthritis (OA), and patients with psoriatic arthritis (PsA). Release of PAD from neutrophils was investigated by Western blotting, mass spectrometry, immunofluorescence staining, and PAD activity assays. PAD2 and PAD4 protein expression, as well as PAD enzymatic activity, were assessed in the SF of patients with RA and those with OA. RESULTS: Extracellular DNA was detected at significantly higher levels in RA SF than in OA SF (P < 0.001) or PsA SF (P < 0.05), and its expression levels correlated with neutrophil concentrations and PAD activity in RA SF. Necrotic neutrophils released less soluble extracellular DNA compared to NETotic cells in vitro (P < 0.05). Higher PAD activity was detected in RA SF than in OA SF (P < 0.05). The citrullinated proteins PAD2 and PAD4 were found attached to NETs and also freely diffused in the supernatant. PAD enzymatic activity was detected in supernatants of neutrophils undergoing either NETosis or necrosis. CONCLUSION: Release of active PAD isoforms into the SF by neutrophil cell death is a plausible explanation for the generation of extracellular autoantigens in RA. John Wiley and Sons Inc. 2015-12 2015-11-25 /pmc/articles/PMC4832324/ /pubmed/26245941 http://dx.doi.org/10.1002/art.39313 Text en © 2015 The Authors. Arthritis & Rheumatolgy published by Wiley Periodicals, Inc. on behalf of the American College of Rheumatology. This is an open access article under the terms of the Creative Commons Attribution (http://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Rheumatoid Arthritis
Spengler, Julia
Lugonja, Božo
Jimmy Ytterberg, A.
Zubarev, Roman A.
Creese, Andrew J.
Pearson, Mark J.
Grant, Melissa M.
Milward, Michael
Lundberg, Karin
Buckley, Christopher D.
Filer, Andrew
Raza, Karim
Cooper, Paul R.
Chapple, Iain L.
Scheel‐Toellner, Dagmar
Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title_full Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title_fullStr Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title_full_unstemmed Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title_short Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
title_sort release of active peptidyl arginine deiminases by neutrophils can explain production of extracellular citrullinated autoantigens in rheumatoid arthritis synovial fluid
topic Rheumatoid Arthritis
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4832324/
https://www.ncbi.nlm.nih.gov/pubmed/26245941
http://dx.doi.org/10.1002/art.39313
work_keys_str_mv AT spenglerjulia releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT lugonjabozo releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT jimmyytterberga releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT zubarevromana releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT creeseandrewj releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT pearsonmarkj releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT grantmelissam releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT milwardmichael releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT lundbergkarin releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT buckleychristopherd releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT filerandrew releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT razakarim releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT cooperpaulr releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT chappleiainl releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid
AT scheeltoellnerdagmar releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid