Cargando…
Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid
OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4832324/ https://www.ncbi.nlm.nih.gov/pubmed/26245941 http://dx.doi.org/10.1002/art.39313 |
_version_ | 1782427235166191616 |
---|---|
author | Spengler, Julia Lugonja, Božo Jimmy Ytterberg, A. Zubarev, Roman A. Creese, Andrew J. Pearson, Mark J. Grant, Melissa M. Milward, Michael Lundberg, Karin Buckley, Christopher D. Filer, Andrew Raza, Karim Cooper, Paul R. Chapple, Iain L. Scheel‐Toellner, Dagmar |
author_facet | Spengler, Julia Lugonja, Božo Jimmy Ytterberg, A. Zubarev, Roman A. Creese, Andrew J. Pearson, Mark J. Grant, Melissa M. Milward, Michael Lundberg, Karin Buckley, Christopher D. Filer, Andrew Raza, Karim Cooper, Paul R. Chapple, Iain L. Scheel‐Toellner, Dagmar |
author_sort | Spengler, Julia |
collection | PubMed |
description | OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease flares. This study was undertaken to test the hypothesis that neutrophil cell death, induced by either NETosis (extrusion of genomic DNA–protein complexes known as neutrophil extracellular traps [NETs]) or necrosis, can contribute to production of autoantigens in the inflamed joint. METHODS: Extracellular DNA was quantified in the SF of patients with RA, patients with osteoarthritis (OA), and patients with psoriatic arthritis (PsA). Release of PAD from neutrophils was investigated by Western blotting, mass spectrometry, immunofluorescence staining, and PAD activity assays. PAD2 and PAD4 protein expression, as well as PAD enzymatic activity, were assessed in the SF of patients with RA and those with OA. RESULTS: Extracellular DNA was detected at significantly higher levels in RA SF than in OA SF (P < 0.001) or PsA SF (P < 0.05), and its expression levels correlated with neutrophil concentrations and PAD activity in RA SF. Necrotic neutrophils released less soluble extracellular DNA compared to NETotic cells in vitro (P < 0.05). Higher PAD activity was detected in RA SF than in OA SF (P < 0.05). The citrullinated proteins PAD2 and PAD4 were found attached to NETs and also freely diffused in the supernatant. PAD enzymatic activity was detected in supernatants of neutrophils undergoing either NETosis or necrosis. CONCLUSION: Release of active PAD isoforms into the SF by neutrophil cell death is a plausible explanation for the generation of extracellular autoantigens in RA. |
format | Online Article Text |
id | pubmed-4832324 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-48323242016-06-24 Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid Spengler, Julia Lugonja, Božo Jimmy Ytterberg, A. Zubarev, Roman A. Creese, Andrew J. Pearson, Mark J. Grant, Melissa M. Milward, Michael Lundberg, Karin Buckley, Christopher D. Filer, Andrew Raza, Karim Cooper, Paul R. Chapple, Iain L. Scheel‐Toellner, Dagmar Arthritis Rheumatol Rheumatoid Arthritis OBJECTIVE: In the majority of patients with rheumatoid arthritis (RA), antibodies specifically recognize citrullinated autoantigens that are generated by peptidylarginine deiminases (PADs). Neutrophils express high levels of PAD and accumulate in the synovial fluid (SF) of RA patients during disease flares. This study was undertaken to test the hypothesis that neutrophil cell death, induced by either NETosis (extrusion of genomic DNA–protein complexes known as neutrophil extracellular traps [NETs]) or necrosis, can contribute to production of autoantigens in the inflamed joint. METHODS: Extracellular DNA was quantified in the SF of patients with RA, patients with osteoarthritis (OA), and patients with psoriatic arthritis (PsA). Release of PAD from neutrophils was investigated by Western blotting, mass spectrometry, immunofluorescence staining, and PAD activity assays. PAD2 and PAD4 protein expression, as well as PAD enzymatic activity, were assessed in the SF of patients with RA and those with OA. RESULTS: Extracellular DNA was detected at significantly higher levels in RA SF than in OA SF (P < 0.001) or PsA SF (P < 0.05), and its expression levels correlated with neutrophil concentrations and PAD activity in RA SF. Necrotic neutrophils released less soluble extracellular DNA compared to NETotic cells in vitro (P < 0.05). Higher PAD activity was detected in RA SF than in OA SF (P < 0.05). The citrullinated proteins PAD2 and PAD4 were found attached to NETs and also freely diffused in the supernatant. PAD enzymatic activity was detected in supernatants of neutrophils undergoing either NETosis or necrosis. CONCLUSION: Release of active PAD isoforms into the SF by neutrophil cell death is a plausible explanation for the generation of extracellular autoantigens in RA. John Wiley and Sons Inc. 2015-12 2015-11-25 /pmc/articles/PMC4832324/ /pubmed/26245941 http://dx.doi.org/10.1002/art.39313 Text en © 2015 The Authors. Arthritis & Rheumatolgy published by Wiley Periodicals, Inc. on behalf of the American College of Rheumatology. This is an open access article under the terms of the Creative Commons Attribution (http://creativecommons.org/licenses/by/4.0/) License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Rheumatoid Arthritis Spengler, Julia Lugonja, Božo Jimmy Ytterberg, A. Zubarev, Roman A. Creese, Andrew J. Pearson, Mark J. Grant, Melissa M. Milward, Michael Lundberg, Karin Buckley, Christopher D. Filer, Andrew Raza, Karim Cooper, Paul R. Chapple, Iain L. Scheel‐Toellner, Dagmar Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title | Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title_full | Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title_fullStr | Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title_full_unstemmed | Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title_short | Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid |
title_sort | release of active peptidyl arginine deiminases by neutrophils can explain production of extracellular citrullinated autoantigens in rheumatoid arthritis synovial fluid |
topic | Rheumatoid Arthritis |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4832324/ https://www.ncbi.nlm.nih.gov/pubmed/26245941 http://dx.doi.org/10.1002/art.39313 |
work_keys_str_mv | AT spenglerjulia releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT lugonjabozo releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT jimmyytterberga releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT zubarevromana releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT creeseandrewj releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT pearsonmarkj releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT grantmelissam releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT milwardmichael releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT lundbergkarin releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT buckleychristopherd releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT filerandrew releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT razakarim releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT cooperpaulr releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT chappleiainl releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid AT scheeltoellnerdagmar releaseofactivepeptidylargininedeiminasesbyneutrophilscanexplainproductionofextracellularcitrullinatedautoantigensinrheumatoidarthritissynovialfluid |