Cargando…
Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the pe...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Medknow Publications & Media Pvt Ltd
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4836259/ https://www.ncbi.nlm.nih.gov/pubmed/25673458 http://dx.doi.org/10.4103/0366-6999.151110 |
_version_ | 1782427736912953344 |
---|---|
author | Shi, Dong Liu, Yun-Yu Li, Wei Zhang, Xin Sun, Xiao-Jun Xu, Li Zhang, Li Chen, Zhi-Bin Meng, Huan-Xin |
author_facet | Shi, Dong Liu, Yun-Yu Li, Wei Zhang, Xin Sun, Xiao-Jun Xu, Li Zhang, Li Chen, Zhi-Bin Meng, Huan-Xin |
author_sort | Shi, Dong |
collection | PubMed |
description | BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. METHODS: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. RESULTS: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). CONCLUSIONS: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients. |
format | Online Article Text |
id | pubmed-4836259 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Medknow Publications & Media Pvt Ltd |
record_format | MEDLINE/PubMed |
spelling | pubmed-48362592016-04-29 Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis Shi, Dong Liu, Yun-Yu Li, Wei Zhang, Xin Sun, Xiao-Jun Xu, Li Zhang, Li Chen, Zhi-Bin Meng, Huan-Xin Chin Med J (Engl) Original Article BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. METHODS: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. RESULTS: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). CONCLUSIONS: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients. Medknow Publications & Media Pvt Ltd 2015-02-20 /pmc/articles/PMC4836259/ /pubmed/25673458 http://dx.doi.org/10.4103/0366-6999.151110 Text en Copyright: © 2015 Chinese Medical Journal http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms. |
spellingShingle | Original Article Shi, Dong Liu, Yun-Yu Li, Wei Zhang, Xin Sun, Xiao-Jun Xu, Li Zhang, Li Chen, Zhi-Bin Meng, Huan-Xin Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title | Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title_full | Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title_fullStr | Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title_full_unstemmed | Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title_short | Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis |
title_sort | association between plasma leptin level and systemic inflammatory markers in patients with aggressive periodontitis |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4836259/ https://www.ncbi.nlm.nih.gov/pubmed/25673458 http://dx.doi.org/10.4103/0366-6999.151110 |
work_keys_str_mv | AT shidong associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT liuyunyu associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT liwei associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT zhangxin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT sunxiaojun associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT xuli associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT zhangli associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT chenzhibin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis AT menghuanxin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis |