Cargando…

Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis

BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the pe...

Descripción completa

Detalles Bibliográficos
Autores principales: Shi, Dong, Liu, Yun-Yu, Li, Wei, Zhang, Xin, Sun, Xiao-Jun, Xu, Li, Zhang, Li, Chen, Zhi-Bin, Meng, Huan-Xin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Medknow Publications & Media Pvt Ltd 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4836259/
https://www.ncbi.nlm.nih.gov/pubmed/25673458
http://dx.doi.org/10.4103/0366-6999.151110
_version_ 1782427736912953344
author Shi, Dong
Liu, Yun-Yu
Li, Wei
Zhang, Xin
Sun, Xiao-Jun
Xu, Li
Zhang, Li
Chen, Zhi-Bin
Meng, Huan-Xin
author_facet Shi, Dong
Liu, Yun-Yu
Li, Wei
Zhang, Xin
Sun, Xiao-Jun
Xu, Li
Zhang, Li
Chen, Zhi-Bin
Meng, Huan-Xin
author_sort Shi, Dong
collection PubMed
description BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. METHODS: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. RESULTS: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). CONCLUSIONS: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients.
format Online
Article
Text
id pubmed-4836259
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Medknow Publications & Media Pvt Ltd
record_format MEDLINE/PubMed
spelling pubmed-48362592016-04-29 Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis Shi, Dong Liu, Yun-Yu Li, Wei Zhang, Xin Sun, Xiao-Jun Xu, Li Zhang, Li Chen, Zhi-Bin Meng, Huan-Xin Chin Med J (Engl) Original Article BACKGROUND: Increasing evidence supports an association between periodontitis and systemic diseases. Leptin is involved both in the energy metabolism and inflammatory processes and is suggested to be a link between periodontal infection and systemic health. The present study aimed to evaluate the peripheral leptin concentration in patients with aggressive periodontitis (AgP) and to explore the relationship between leptin and systemic inflammation. METHODS: Ninety patients with AgP visiting the Clinic of the Periodontology Department, Peking University School and Hospital of Stomatology between July 2001 and May 2006, and 44 healthy controls (staff and student volunteers in the same institute) were recruited. Plasma levels of leptin and inflammatory cytokines including interleukin (IL)-1β, IL-6, tumor necrosis factor-α (TNF-α) and C-reactive protein (CRP) were measured by enzyme-linked immunosorbent assay. Correlation and multiple linear regression analysis were performed to analyze the association between plasma leptin level and other variables. RESULTS: Plasma leptin level of AgP group was significantly higher than that of the control group (19.7 ± 4.4 ng/ml vs. 7.5 ± 1.3 ng/ml, P < 0.01). After controlling for age, gender, and body mass index, positive correlation was observed between plasma leptin concentration and log-transformed levels of pro-inflammatory cytokines (IL-1β, IL-6, TNF-α and CRP), and the partial correlation coefficients ranged from 0.199 to 0.376 (P < 0.05). Log-transformed IL-1β and IL-6 levels entered the final regression model (standardized β were 0.422 and 0.461 respectively, P < 0.01). CONCLUSIONS: Elevated plasma leptin concentration may be associated with increased systemic levels of inflammatory markers in AgP patients. Medknow Publications & Media Pvt Ltd 2015-02-20 /pmc/articles/PMC4836259/ /pubmed/25673458 http://dx.doi.org/10.4103/0366-6999.151110 Text en Copyright: © 2015 Chinese Medical Journal http://creativecommons.org/licenses/by-nc-sa/3.0 This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as the author is credited and the new creations are licensed under the identical terms.
spellingShingle Original Article
Shi, Dong
Liu, Yun-Yu
Li, Wei
Zhang, Xin
Sun, Xiao-Jun
Xu, Li
Zhang, Li
Chen, Zhi-Bin
Meng, Huan-Xin
Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_full Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_fullStr Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_full_unstemmed Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_short Association between Plasma Leptin Level and Systemic Inflammatory Markers in Patients with Aggressive Periodontitis
title_sort association between plasma leptin level and systemic inflammatory markers in patients with aggressive periodontitis
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4836259/
https://www.ncbi.nlm.nih.gov/pubmed/25673458
http://dx.doi.org/10.4103/0366-6999.151110
work_keys_str_mv AT shidong associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT liuyunyu associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT liwei associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT zhangxin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT sunxiaojun associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT xuli associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT zhangli associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT chenzhibin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis
AT menghuanxin associationbetweenplasmaleptinlevelandsystemicinflammatorymarkersinpatientswithaggressiveperiodontitis