Cargando…
Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels
Regulation of cell volume is an important aspect of cellular homeostasis during neural activity. This volume regulation is thought to be mediated by activation of specific transporters, aquaporin, and volume regulated anion channels (VRAC). In cultured astrocytes, it was reported that swelling-induc...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Society for Brain and Neural Science
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4844565/ https://www.ncbi.nlm.nih.gov/pubmed/27122993 http://dx.doi.org/10.5607/en.2016.25.2.72 |
_version_ | 1782428792837373952 |
---|---|
author | Lee, Jaekwang Han, Young-Eun Favorov, Oleg Tommerdahl, Mark Whitsel, Barry Lee, C. Justin |
author_facet | Lee, Jaekwang Han, Young-Eun Favorov, Oleg Tommerdahl, Mark Whitsel, Barry Lee, C. Justin |
author_sort | Lee, Jaekwang |
collection | PubMed |
description | Regulation of cell volume is an important aspect of cellular homeostasis during neural activity. This volume regulation is thought to be mediated by activation of specific transporters, aquaporin, and volume regulated anion channels (VRAC). In cultured astrocytes, it was reported that swelling-induced mitogen-activated protein (MAP) kinase activation is required to open VRAC, which are thought to be important in regulatory volume decrease and in the response of CNS to trauma and excitotoxicity. It has been also described that sodium fluoride (NaF), a recognized G-protein activator and protein phosphatase inhibitor, leads to a significant MAP kinase activation in endothelial cells. However, NaF's effect in volume regulation in the brain is not known yet. Here, we investigated the mechanism of NaF-induced volume change in rat and mouse hippocampal slices using intrinsic optical signal (IOS) recording, in which we measured relative changes in intracellular and extracellular volume as changes in light transmittance through brain slices. We found that NaF (1~5 mM) application induced a reduction in light transmittance (decreased volume) in CA1 hippocampus, which was completely reversed by MAP kinase inhibitor U0126 (10 µM). We also observed that NaF-induced volume reduction was blocked by anion channel blockers, suggesting that NaF-induced volume reduction could be mediated by VRAC. Overall, our results propose a novel molecular mechanism of NaF-induced volume reduction via MAP kinase signaling pathway by activation of VRAC. |
format | Online Article Text |
id | pubmed-4844565 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | The Korean Society for Brain and Neural Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-48445652016-04-27 Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels Lee, Jaekwang Han, Young-Eun Favorov, Oleg Tommerdahl, Mark Whitsel, Barry Lee, C. Justin Exp Neurobiol Original Article Regulation of cell volume is an important aspect of cellular homeostasis during neural activity. This volume regulation is thought to be mediated by activation of specific transporters, aquaporin, and volume regulated anion channels (VRAC). In cultured astrocytes, it was reported that swelling-induced mitogen-activated protein (MAP) kinase activation is required to open VRAC, which are thought to be important in regulatory volume decrease and in the response of CNS to trauma and excitotoxicity. It has been also described that sodium fluoride (NaF), a recognized G-protein activator and protein phosphatase inhibitor, leads to a significant MAP kinase activation in endothelial cells. However, NaF's effect in volume regulation in the brain is not known yet. Here, we investigated the mechanism of NaF-induced volume change in rat and mouse hippocampal slices using intrinsic optical signal (IOS) recording, in which we measured relative changes in intracellular and extracellular volume as changes in light transmittance through brain slices. We found that NaF (1~5 mM) application induced a reduction in light transmittance (decreased volume) in CA1 hippocampus, which was completely reversed by MAP kinase inhibitor U0126 (10 µM). We also observed that NaF-induced volume reduction was blocked by anion channel blockers, suggesting that NaF-induced volume reduction could be mediated by VRAC. Overall, our results propose a novel molecular mechanism of NaF-induced volume reduction via MAP kinase signaling pathway by activation of VRAC. The Korean Society for Brain and Neural Science 2016-04 2016-04-21 /pmc/articles/PMC4844565/ /pubmed/27122993 http://dx.doi.org/10.5607/en.2016.25.2.72 Text en Copyright © Experimental Neurobiology 2016. http://creativecommons.org/licenses/by-nc/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Lee, Jaekwang Han, Young-Eun Favorov, Oleg Tommerdahl, Mark Whitsel, Barry Lee, C. Justin Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title | Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title_full | Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title_fullStr | Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title_full_unstemmed | Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title_short | Fluoride Induces a Volume Reduction in CA1 Hippocampal Slices Via MAP Kinase Pathway Through Volume Regulated Anion Channels |
title_sort | fluoride induces a volume reduction in ca1 hippocampal slices via map kinase pathway through volume regulated anion channels |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4844565/ https://www.ncbi.nlm.nih.gov/pubmed/27122993 http://dx.doi.org/10.5607/en.2016.25.2.72 |
work_keys_str_mv | AT leejaekwang fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels AT hanyoungeun fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels AT favorovoleg fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels AT tommerdahlmark fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels AT whitselbarry fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels AT leecjustin fluorideinducesavolumereductioninca1hippocampalslicesviamapkinasepathwaythroughvolumeregulatedanionchannels |