Cargando…

Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review

BACKGROUND: Differential diagnosis between sepsis and non-infectious inflammatory disorders demands improved biomarkers. Soluble Triggering Receptor Expression on Myeloid cells (sTREM-1) is an activating receptor whose role has been studied throughout the last decade. We performed a systematic revie...

Descripción completa

Detalles Bibliográficos
Autores principales: Pontrelli, Giuseppe, De Crescenzo, Franco, Buzzetti, Roberto, Calò Carducci, Francesca, Jenkner, Alessandro, Amodio, Donato, De Luca, Maia, Chiurchiù, Sara, Davies, Elin Haf, Simonetti, Alessandra, Ferretti, Elena, Della Corte, Martina, Gramatica, Luca, Livadiotti, Susanna, Rossi, Paolo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4847353/
https://www.ncbi.nlm.nih.gov/pubmed/27116911
http://dx.doi.org/10.1186/s13052-016-0242-y
_version_ 1782429199961686016
author Pontrelli, Giuseppe
De Crescenzo, Franco
Buzzetti, Roberto
Calò Carducci, Francesca
Jenkner, Alessandro
Amodio, Donato
De Luca, Maia
Chiurchiù, Sara
Davies, Elin Haf
Simonetti, Alessandra
Ferretti, Elena
Della Corte, Martina
Gramatica, Luca
Livadiotti, Susanna
Rossi, Paolo
author_facet Pontrelli, Giuseppe
De Crescenzo, Franco
Buzzetti, Roberto
Calò Carducci, Francesca
Jenkner, Alessandro
Amodio, Donato
De Luca, Maia
Chiurchiù, Sara
Davies, Elin Haf
Simonetti, Alessandra
Ferretti, Elena
Della Corte, Martina
Gramatica, Luca
Livadiotti, Susanna
Rossi, Paolo
author_sort Pontrelli, Giuseppe
collection PubMed
description BACKGROUND: Differential diagnosis between sepsis and non-infectious inflammatory disorders demands improved biomarkers. Soluble Triggering Receptor Expression on Myeloid cells (sTREM-1) is an activating receptor whose role has been studied throughout the last decade. We performed a systematic review to evaluate the accuracy of plasma sTREM-1 levels in the diagnosis of sepsis in children with Systemic Inflammatory Response Syndrome (SIRS). METHODS: A literature search of PubMed, Cochrane Central Register of Controlled Trials, Cumulative Index to Nursing and Allied Health Literature (CINAHL) and ISI Web of Knowledge databases was performed using specific search terms. Studies were included if they assessed the diagnostic accuracy of plasma sTREM-1 for sepsis in paediatric patients with SIRS. Data on sensitivity, specificity, positive predictive value, negative predictive value, area under receiver operating characteristic curve were extracted. The methodological quality of each study was assessed using a checklist based on the Quality Assessment Tool for Diagnostic Accuracy Studies. RESULTS: Nine studies comprising 961 patients were included, four of which were in newborns, three in children and two in children with febrile neutropenia. Some data from single studies support a role of sTREM-1 as a diagnostic tool in pediatric sepsis, but cannot be considered conclusive, because a quantitative synthesis was not possible, due to heterogeneity in studies design. CONCLUSIONS: This systematic review suggests that available data are insufficient to support a role for sTREM in the diagnosis and follow-up of paediatric sepsis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13052-016-0242-y) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4847353
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-48473532016-04-28 Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review Pontrelli, Giuseppe De Crescenzo, Franco Buzzetti, Roberto Calò Carducci, Francesca Jenkner, Alessandro Amodio, Donato De Luca, Maia Chiurchiù, Sara Davies, Elin Haf Simonetti, Alessandra Ferretti, Elena Della Corte, Martina Gramatica, Luca Livadiotti, Susanna Rossi, Paolo Ital J Pediatr Research BACKGROUND: Differential diagnosis between sepsis and non-infectious inflammatory disorders demands improved biomarkers. Soluble Triggering Receptor Expression on Myeloid cells (sTREM-1) is an activating receptor whose role has been studied throughout the last decade. We performed a systematic review to evaluate the accuracy of plasma sTREM-1 levels in the diagnosis of sepsis in children with Systemic Inflammatory Response Syndrome (SIRS). METHODS: A literature search of PubMed, Cochrane Central Register of Controlled Trials, Cumulative Index to Nursing and Allied Health Literature (CINAHL) and ISI Web of Knowledge databases was performed using specific search terms. Studies were included if they assessed the diagnostic accuracy of plasma sTREM-1 for sepsis in paediatric patients with SIRS. Data on sensitivity, specificity, positive predictive value, negative predictive value, area under receiver operating characteristic curve were extracted. The methodological quality of each study was assessed using a checklist based on the Quality Assessment Tool for Diagnostic Accuracy Studies. RESULTS: Nine studies comprising 961 patients were included, four of which were in newborns, three in children and two in children with febrile neutropenia. Some data from single studies support a role of sTREM-1 as a diagnostic tool in pediatric sepsis, but cannot be considered conclusive, because a quantitative synthesis was not possible, due to heterogeneity in studies design. CONCLUSIONS: This systematic review suggests that available data are insufficient to support a role for sTREM in the diagnosis and follow-up of paediatric sepsis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13052-016-0242-y) contains supplementary material, which is available to authorized users. BioMed Central 2016-04-27 /pmc/articles/PMC4847353/ /pubmed/27116911 http://dx.doi.org/10.1186/s13052-016-0242-y Text en © Pontrelli et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Pontrelli, Giuseppe
De Crescenzo, Franco
Buzzetti, Roberto
Calò Carducci, Francesca
Jenkner, Alessandro
Amodio, Donato
De Luca, Maia
Chiurchiù, Sara
Davies, Elin Haf
Simonetti, Alessandra
Ferretti, Elena
Della Corte, Martina
Gramatica, Luca
Livadiotti, Susanna
Rossi, Paolo
Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title_full Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title_fullStr Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title_full_unstemmed Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title_short Diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
title_sort diagnostic value of soluble triggering receptor expressed on myeloid cells in paediatric sepsis: a systematic review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4847353/
https://www.ncbi.nlm.nih.gov/pubmed/27116911
http://dx.doi.org/10.1186/s13052-016-0242-y
work_keys_str_mv AT pontrelligiuseppe diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT decrescenzofranco diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT buzzettiroberto diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT calocarduccifrancesca diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT jenkneralessandro diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT amodiodonato diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT delucamaia diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT chiurchiusara diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT davieselinhaf diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT simonettialessandra diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT ferrettielena diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT dellacortemartina diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT gramaticaluca diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT livadiottisusanna diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview
AT rossipaolo diagnosticvalueofsolubletriggeringreceptorexpressedonmyeloidcellsinpaediatricsepsisasystematicreview