Cargando…
Physician-facilitated designation of proxy decision-makers: family physician perceptions
BACKGROUND: Among the challenges encountered during the care of patients at the end-of-life (EOL), eliciting preferences of patients with whom there is no ability to communicate is common and stressful for all those concerned and charged with patient care. Legal facilities available include patient...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4851817/ https://www.ncbi.nlm.nih.gov/pubmed/27134719 http://dx.doi.org/10.1186/s13584-016-0059-6 |
_version_ | 1782429868457197568 |
---|---|
author | Lifshitz, Gideon Cohen, Matan J. Shmilovitz, Hila Brezis, Mayer Lahad, Amnon Ben-Yehuda, Arie |
author_facet | Lifshitz, Gideon Cohen, Matan J. Shmilovitz, Hila Brezis, Mayer Lahad, Amnon Ben-Yehuda, Arie |
author_sort | Lifshitz, Gideon |
collection | PubMed |
description | BACKGROUND: Among the challenges encountered during the care of patients at the end-of-life (EOL), eliciting preferences of patients with whom there is no ability to communicate is common and stressful for all those concerned and charged with patient care. Legal facilities available include patient delegation of proxy decision-makers (PDM) prior to communication incapacity. We sought to estimate family physician awareness and attitude with regard to these aspects of patient care. METHODS: A telephone survey of family physicians in the Jerusalem, Israel, district using a standard questionnaire. RESULTS: 74 family physicians responded to the survey. The response rate was 42 % and the cooperation rate was 66 %. Most of the respondents, (64 %), reported knowing that the PDM delegation facility exists, though only 24 % claimed to have suggested to their patients that they consider this option. Approximately three-quarters, (78 %), treat patients with whom they discussed other aspects of severe disease, disability or EOL. None of the physicians working predominantly with religiously observant groups reported suggesting PDM delegation. CONCLUSIONS: There is an apparent gap between family physician knowledge and their performance to empower the persistence of patient autonomy, should communication ability cease. System-wide interventions to increase EOL communication skills, starting at medical school and henceforth, are necessary in order to promote better EOL care and meaningful resource use. |
format | Online Article Text |
id | pubmed-4851817 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-48518172016-05-01 Physician-facilitated designation of proxy decision-makers: family physician perceptions Lifshitz, Gideon Cohen, Matan J. Shmilovitz, Hila Brezis, Mayer Lahad, Amnon Ben-Yehuda, Arie Isr J Health Policy Res Original Research Article BACKGROUND: Among the challenges encountered during the care of patients at the end-of-life (EOL), eliciting preferences of patients with whom there is no ability to communicate is common and stressful for all those concerned and charged with patient care. Legal facilities available include patient delegation of proxy decision-makers (PDM) prior to communication incapacity. We sought to estimate family physician awareness and attitude with regard to these aspects of patient care. METHODS: A telephone survey of family physicians in the Jerusalem, Israel, district using a standard questionnaire. RESULTS: 74 family physicians responded to the survey. The response rate was 42 % and the cooperation rate was 66 %. Most of the respondents, (64 %), reported knowing that the PDM delegation facility exists, though only 24 % claimed to have suggested to their patients that they consider this option. Approximately three-quarters, (78 %), treat patients with whom they discussed other aspects of severe disease, disability or EOL. None of the physicians working predominantly with religiously observant groups reported suggesting PDM delegation. CONCLUSIONS: There is an apparent gap between family physician knowledge and their performance to empower the persistence of patient autonomy, should communication ability cease. System-wide interventions to increase EOL communication skills, starting at medical school and henceforth, are necessary in order to promote better EOL care and meaningful resource use. BioMed Central 2016-04-30 /pmc/articles/PMC4851817/ /pubmed/27134719 http://dx.doi.org/10.1186/s13584-016-0059-6 Text en © Lifshitz et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Original Research Article Lifshitz, Gideon Cohen, Matan J. Shmilovitz, Hila Brezis, Mayer Lahad, Amnon Ben-Yehuda, Arie Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title | Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title_full | Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title_fullStr | Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title_full_unstemmed | Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title_short | Physician-facilitated designation of proxy decision-makers: family physician perceptions |
title_sort | physician-facilitated designation of proxy decision-makers: family physician perceptions |
topic | Original Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4851817/ https://www.ncbi.nlm.nih.gov/pubmed/27134719 http://dx.doi.org/10.1186/s13584-016-0059-6 |
work_keys_str_mv | AT lifshitzgideon physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions AT cohenmatanj physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions AT shmilovitzhila physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions AT brezismayer physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions AT lahadamnon physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions AT benyehudaarie physicianfacilitateddesignationofproxydecisionmakersfamilyphysicianperceptions |