Cargando…

Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours

Canine mammary tumours (CMT) are the most common neoplasia in unspayed female dogs. CMTs are suitable naturally occurring models for human breast cancer and share many characteristics, indicating that the genetic causes could also be shared. We have performed a genome-wide association study (GWAS) i...

Descripción completa

Detalles Bibliográficos
Autores principales: Melin, Malin, Rivera, Patricio, Arendt, Maja, Elvers, Ingegerd, Murén, Eva, Gustafson, Ulla, Starkey, Mike, Borge, Kaja Sverdrup, Lingaas, Frode, Häggström, Jens, Saellström, Sara, Rönnberg, Henrik, Lindblad-Toh, Kerstin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4861258/
https://www.ncbi.nlm.nih.gov/pubmed/27158822
http://dx.doi.org/10.1371/journal.pgen.1006029
_version_ 1782431190559490048
author Melin, Malin
Rivera, Patricio
Arendt, Maja
Elvers, Ingegerd
Murén, Eva
Gustafson, Ulla
Starkey, Mike
Borge, Kaja Sverdrup
Lingaas, Frode
Häggström, Jens
Saellström, Sara
Rönnberg, Henrik
Lindblad-Toh, Kerstin
author_facet Melin, Malin
Rivera, Patricio
Arendt, Maja
Elvers, Ingegerd
Murén, Eva
Gustafson, Ulla
Starkey, Mike
Borge, Kaja Sverdrup
Lingaas, Frode
Häggström, Jens
Saellström, Sara
Rönnberg, Henrik
Lindblad-Toh, Kerstin
author_sort Melin, Malin
collection PubMed
description Canine mammary tumours (CMT) are the most common neoplasia in unspayed female dogs. CMTs are suitable naturally occurring models for human breast cancer and share many characteristics, indicating that the genetic causes could also be shared. We have performed a genome-wide association study (GWAS) in English Springer Spaniel dogs and identified a genome-wide significant locus on chromosome 11 (p(raw) = 5.6x10(-7), p(perm) = 0.019). The most associated haplotype spans a 446 kb region overlapping the CDK5RAP2 gene. The CDK5RAP2 protein has a function in cell cycle regulation and could potentially have an impact on response to chemotherapy treatment. Two additional loci, both on chromosome 27, were nominally associated (p(raw) = 1.97x10(-5) and p(raw) = 8.30x10(-6)). The three loci explain 28.1±10.0% of the phenotypic variation seen in the cohort, whereas the top ten associated regions account for 38.2±10.8% of the risk. Furthermore, the ten GWAS loci and regions with reduced genetic variability are significantly enriched for snoRNAs and tumour-associated antigen genes, suggesting a role for these genes in CMT development. We have identified several candidate genes associated with canine mammary tumours, including CDK5RAP2. Our findings enable further comparative studies to investigate the genes and pathways in human breast cancer patients.
format Online
Article
Text
id pubmed-4861258
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-48612582016-05-13 Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours Melin, Malin Rivera, Patricio Arendt, Maja Elvers, Ingegerd Murén, Eva Gustafson, Ulla Starkey, Mike Borge, Kaja Sverdrup Lingaas, Frode Häggström, Jens Saellström, Sara Rönnberg, Henrik Lindblad-Toh, Kerstin PLoS Genet Research Article Canine mammary tumours (CMT) are the most common neoplasia in unspayed female dogs. CMTs are suitable naturally occurring models for human breast cancer and share many characteristics, indicating that the genetic causes could also be shared. We have performed a genome-wide association study (GWAS) in English Springer Spaniel dogs and identified a genome-wide significant locus on chromosome 11 (p(raw) = 5.6x10(-7), p(perm) = 0.019). The most associated haplotype spans a 446 kb region overlapping the CDK5RAP2 gene. The CDK5RAP2 protein has a function in cell cycle regulation and could potentially have an impact on response to chemotherapy treatment. Two additional loci, both on chromosome 27, were nominally associated (p(raw) = 1.97x10(-5) and p(raw) = 8.30x10(-6)). The three loci explain 28.1±10.0% of the phenotypic variation seen in the cohort, whereas the top ten associated regions account for 38.2±10.8% of the risk. Furthermore, the ten GWAS loci and regions with reduced genetic variability are significantly enriched for snoRNAs and tumour-associated antigen genes, suggesting a role for these genes in CMT development. We have identified several candidate genes associated with canine mammary tumours, including CDK5RAP2. Our findings enable further comparative studies to investigate the genes and pathways in human breast cancer patients. Public Library of Science 2016-05-09 /pmc/articles/PMC4861258/ /pubmed/27158822 http://dx.doi.org/10.1371/journal.pgen.1006029 Text en © 2016 Melin et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Melin, Malin
Rivera, Patricio
Arendt, Maja
Elvers, Ingegerd
Murén, Eva
Gustafson, Ulla
Starkey, Mike
Borge, Kaja Sverdrup
Lingaas, Frode
Häggström, Jens
Saellström, Sara
Rönnberg, Henrik
Lindblad-Toh, Kerstin
Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title_full Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title_fullStr Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title_full_unstemmed Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title_short Genome-Wide Analysis Identifies Germ-Line Risk Factors Associated with Canine Mammary Tumours
title_sort genome-wide analysis identifies germ-line risk factors associated with canine mammary tumours
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4861258/
https://www.ncbi.nlm.nih.gov/pubmed/27158822
http://dx.doi.org/10.1371/journal.pgen.1006029
work_keys_str_mv AT melinmalin genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT riverapatricio genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT arendtmaja genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT elversingegerd genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT mureneva genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT gustafsonulla genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT starkeymike genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT borgekajasverdrup genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT lingaasfrode genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT haggstromjens genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT saellstromsara genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT ronnberghenrik genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours
AT lindbladtohkerstin genomewideanalysisidentifiesgermlineriskfactorsassociatedwithcaninemammarytumours