Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana

To assess the prevalence of malaria among illegal gold miners in the French Guiana rainforest, we screened 205 miners during May–June 2014. Malaria prevalence was 48.3%; 48.5% of cases were asymptomatic. Patients reported self-medication with artemisinin-based combination therapy. Risk for emergence...

Descripción completa

Detalles Bibliográficos
Autores principales: Pommier de Santi, Vincent, Djossou, Félix, Barthes, Nicolas, Bogreau, Hervé, Hyvert, Georges, Nguyen, Christophe, Pelleau, Stéphane, Legrand, Eric, Musset, Lise, Nacher, Mathieu, Briolant, Sébastien
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Centers for Disease Control and Prevention 2016
Materias:
Dispatch
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4861531/
https://www.ncbi.nlm.nih.gov/pubmed/27089004
http://dx.doi.org/10.3201/eid2205.151957
_version_ 1782431222899671040
author Pommier de Santi, Vincent
Djossou, Félix
Barthes, Nicolas
Bogreau, Hervé
Hyvert, Georges
Nguyen, Christophe
Pelleau, Stéphane
Legrand, Eric
Musset, Lise
Nacher, Mathieu
Briolant, Sébastien
author_facet Pommier de Santi, Vincent
Djossou, Félix
Barthes, Nicolas
Bogreau, Hervé
Hyvert, Georges
Nguyen, Christophe
Pelleau, Stéphane
Legrand, Eric
Musset, Lise
Nacher, Mathieu
Briolant, Sébastien
author_sort Pommier de Santi, Vincent
collection PubMed
description To assess the prevalence of malaria among illegal gold miners in the French Guiana rainforest, we screened 205 miners during May–June 2014. Malaria prevalence was 48.3%; 48.5% of cases were asymptomatic. Patients reported self-medication with artemisinin-based combination therapy. Risk for emergence and spread of artemisinin resistance among gold miners in the rainforest is high.
format Online
Article
Text
id pubmed-4861531
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Centers for Disease Control and Prevention
record_format MEDLINE/PubMed
spelling pubmed-48615312016-05-10 Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana Pommier de Santi, Vincent Djossou, Félix Barthes, Nicolas Bogreau, Hervé Hyvert, Georges Nguyen, Christophe Pelleau, Stéphane Legrand, Eric Musset, Lise Nacher, Mathieu Briolant, Sébastien Emerg Infect Dis Dispatch To assess the prevalence of malaria among illegal gold miners in the French Guiana rainforest, we screened 205 miners during May–June 2014. Malaria prevalence was 48.3%; 48.5% of cases were asymptomatic. Patients reported self-medication with artemisinin-based combination therapy. Risk for emergence and spread of artemisinin resistance among gold miners in the rainforest is high. Centers for Disease Control and Prevention 2016-05 /pmc/articles/PMC4861531/ /pubmed/27089004 http://dx.doi.org/10.3201/eid2205.151957 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited.
spellingShingle Dispatch
Pommier de Santi, Vincent
Djossou, Félix
Barthes, Nicolas
Bogreau, Hervé
Hyvert, Georges
Nguyen, Christophe
Pelleau, Stéphane
Legrand, Eric
Musset, Lise
Nacher, Mathieu
Briolant, Sébastien
Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title_full Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title_fullStr Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title_full_unstemmed Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title_short Malaria Hyperendemicity and Risk for Artemisinin Resistance among Illegal Gold Miners, French Guiana
title_sort malaria hyperendemicity and risk for artemisinin resistance among illegal gold miners, french guiana
topic Dispatch
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4861531/
https://www.ncbi.nlm.nih.gov/pubmed/27089004
http://dx.doi.org/10.3201/eid2205.151957
work_keys_str_mv AT pommierdesantivincent malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT djossoufelix malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT barthesnicolas malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT bogreauherve malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT hyvertgeorges malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT nguyenchristophe malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT pelleaustephane malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT legranderic malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT mussetlise malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT nachermathieu malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana
AT briolantsebastien malariahyperendemicityandriskforartemisininresistanceamongillegalgoldminersfrenchguiana

Ejemplares similares