Cargando…

Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis

BACKGROUND: Cotrimoxazole (CTX) prophylaxis, recommended in HIV-exposed uninfected (HEU) children primarily against HIV-related opportunistic infections, has been shown to have some efficacy against Plasmodium falciparum malaria. The effects of CTX prophylaxis on the acquisition of P. falciparum ant...

Descripción completa

Detalles Bibliográficos
Autores principales: Longwe, Herbert, Phiri, Kamija S., Mbeye, Nyanyiwe M., Gondwe, Thandile, Mandala, Wilson L., Jambo, Kondwani C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4862093/
https://www.ncbi.nlm.nih.gov/pubmed/27165269
http://dx.doi.org/10.1186/s12936-016-1318-2
_version_ 1782431307552260096
author Longwe, Herbert
Phiri, Kamija S.
Mbeye, Nyanyiwe M.
Gondwe, Thandile
Mandala, Wilson L.
Jambo, Kondwani C.
author_facet Longwe, Herbert
Phiri, Kamija S.
Mbeye, Nyanyiwe M.
Gondwe, Thandile
Mandala, Wilson L.
Jambo, Kondwani C.
author_sort Longwe, Herbert
collection PubMed
description BACKGROUND: Cotrimoxazole (CTX) prophylaxis, recommended in HIV-exposed uninfected (HEU) children primarily against HIV-related opportunistic infections, has been shown to have some efficacy against Plasmodium falciparum malaria. The effects of CTX prophylaxis on the acquisition of P. falciparum antigen specific CD4(+) T cells-mediated immunity in HEU children is still not fully understood. METHODS: Peripheral blood was collected from HEU and HIV-unexposed uninfected (HUU) children at 6, 12 and 18 months of age. Proportion of CD4(+) T cells subsets were determined by immunophenotyping. P. falciparum antigen-specific CD4(+) T cells responses were measured by intracellular cytokine staining assay. RESULTS: There were no differences in the proportions of naïve, effector and memory CD4(+) T cell subsets between HEU and HUU children at all ages. There was a trend showing acquisition of P. falciparum-specific IFN-γ and TNF-producing CD4(+) T cells with age in both HUU and HEU children. There was, however, lower frequency of P. falciparum-specific IFN-γ-producing CD4(+) T cells in HEU compared to HUU at 6 and 12 months, which normalized 6 months after stopping CTX prophylaxis. CONCLUSION: The results demonstrate that there is delayed acquisition of P. falciparum-specific IFN-γ-producing CD4(+) T cells in HEU children on daily cotrimoxazole prophylaxis, which is evident at 6 and 12 months of age in comparison to HUU age-matched controls. However, whether this delayed acquisition of P. falciparum-specific IFN-γ-producing CD4(+) T cells leads to higher risk to malaria disease remains unknown and warrants further investigation.
format Online
Article
Text
id pubmed-4862093
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-48620932016-05-11 Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis Longwe, Herbert Phiri, Kamija S. Mbeye, Nyanyiwe M. Gondwe, Thandile Mandala, Wilson L. Jambo, Kondwani C. Malar J Research BACKGROUND: Cotrimoxazole (CTX) prophylaxis, recommended in HIV-exposed uninfected (HEU) children primarily against HIV-related opportunistic infections, has been shown to have some efficacy against Plasmodium falciparum malaria. The effects of CTX prophylaxis on the acquisition of P. falciparum antigen specific CD4(+) T cells-mediated immunity in HEU children is still not fully understood. METHODS: Peripheral blood was collected from HEU and HIV-unexposed uninfected (HUU) children at 6, 12 and 18 months of age. Proportion of CD4(+) T cells subsets were determined by immunophenotyping. P. falciparum antigen-specific CD4(+) T cells responses were measured by intracellular cytokine staining assay. RESULTS: There were no differences in the proportions of naïve, effector and memory CD4(+) T cell subsets between HEU and HUU children at all ages. There was a trend showing acquisition of P. falciparum-specific IFN-γ and TNF-producing CD4(+) T cells with age in both HUU and HEU children. There was, however, lower frequency of P. falciparum-specific IFN-γ-producing CD4(+) T cells in HEU compared to HUU at 6 and 12 months, which normalized 6 months after stopping CTX prophylaxis. CONCLUSION: The results demonstrate that there is delayed acquisition of P. falciparum-specific IFN-γ-producing CD4(+) T cells in HEU children on daily cotrimoxazole prophylaxis, which is evident at 6 and 12 months of age in comparison to HUU age-matched controls. However, whether this delayed acquisition of P. falciparum-specific IFN-γ-producing CD4(+) T cells leads to higher risk to malaria disease remains unknown and warrants further investigation. BioMed Central 2016-05-10 /pmc/articles/PMC4862093/ /pubmed/27165269 http://dx.doi.org/10.1186/s12936-016-1318-2 Text en © The Author(s) 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Longwe, Herbert
Phiri, Kamija S.
Mbeye, Nyanyiwe M.
Gondwe, Thandile
Mandala, Wilson L.
Jambo, Kondwani C.
Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title_full Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title_fullStr Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title_full_unstemmed Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title_short Delayed acquisition of Plasmodium falciparum antigen-specific CD4(+) T cell responses in HIV-exposed uninfected Malawian children receiving daily cotrimoxazole prophylaxis
title_sort delayed acquisition of plasmodium falciparum antigen-specific cd4(+) t cell responses in hiv-exposed uninfected malawian children receiving daily cotrimoxazole prophylaxis
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4862093/
https://www.ncbi.nlm.nih.gov/pubmed/27165269
http://dx.doi.org/10.1186/s12936-016-1318-2
work_keys_str_mv AT longweherbert delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis
AT phirikamijas delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis
AT mbeyenyanyiwem delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis
AT gondwethandile delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis
AT mandalawilsonl delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis
AT jambokondwanic delayedacquisitionofplasmodiumfalciparumantigenspecificcd4tcellresponsesinhivexposeduninfectedmalawianchildrenreceivingdailycotrimoxazoleprophylaxis