Cargando…
R-wave peak time at lead II in Chinese healthy adults
BACKGROUND: Wide QRS complex tachycardia (WCT) is a common arrhythmia. How to differentiate between WCTs is a challenge in clinical practice. Recently R-wave peak time (RWPT) at lead II was reported to be a helpful and simple tool for differentiating WCTs. However, it has remained unknown about the...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4862132/ https://www.ncbi.nlm.nih.gov/pubmed/27165698 http://dx.doi.org/10.1186/s12872-016-0258-7 |
_version_ | 1782431312707059712 |
---|---|
author | Deng, Jinhua Chen, Tingting Zeng, Chujuan Lu, Nan Zhou, Lihong Tan, Xuerui Yu, Min |
author_facet | Deng, Jinhua Chen, Tingting Zeng, Chujuan Lu, Nan Zhou, Lihong Tan, Xuerui Yu, Min |
author_sort | Deng, Jinhua |
collection | PubMed |
description | BACKGROUND: Wide QRS complex tachycardia (WCT) is a common arrhythmia. How to differentiate between WCTs is a challenge in clinical practice. Recently R-wave peak time (RWPT) at lead II was reported to be a helpful and simple tool for differentiating WCTs. However, it has remained unknown about the reference range of RWPT at lead II. In present study, we aimed to investigate the reference range of RWPT at lead II in Chinese healthy adults. METHODS: A retrospective study was conducted in the First Affiliated Hospital of Shantou University Medical College in Southern China. Two thousand four hundred healthy adults aged 21–80 years with no history of structural heart diseases were included. RWPT at lead II was determined. RESULTS: Of 2400 healthy adults, 1200 men and 1200 women were included. The differences of age, mean heart rate and mean QRS duration at lead II between male and female were not significant. RWPT ranged from 16 to 42 ms in male while from 16 to 44 ms in female. The 95 % reference range of RWPT in normal male and female are 19.91 ~ 39.55 ms and 21.75 ~ 37.67 ms, respectively. Compared with the female, the male had a significantly longer RWPT at lead II (29.73 ± 5.01 ms vs 29.71 ± 4.06 ms in female, P = 0.000). CONCLUSION: Our study showed that RWPT at lead II is different between male and female. The male had a significantly longer RWPT at lead II than the female. |
format | Online Article Text |
id | pubmed-4862132 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-48621322016-05-11 R-wave peak time at lead II in Chinese healthy adults Deng, Jinhua Chen, Tingting Zeng, Chujuan Lu, Nan Zhou, Lihong Tan, Xuerui Yu, Min BMC Cardiovasc Disord Research Article BACKGROUND: Wide QRS complex tachycardia (WCT) is a common arrhythmia. How to differentiate between WCTs is a challenge in clinical practice. Recently R-wave peak time (RWPT) at lead II was reported to be a helpful and simple tool for differentiating WCTs. However, it has remained unknown about the reference range of RWPT at lead II. In present study, we aimed to investigate the reference range of RWPT at lead II in Chinese healthy adults. METHODS: A retrospective study was conducted in the First Affiliated Hospital of Shantou University Medical College in Southern China. Two thousand four hundred healthy adults aged 21–80 years with no history of structural heart diseases were included. RWPT at lead II was determined. RESULTS: Of 2400 healthy adults, 1200 men and 1200 women were included. The differences of age, mean heart rate and mean QRS duration at lead II between male and female were not significant. RWPT ranged from 16 to 42 ms in male while from 16 to 44 ms in female. The 95 % reference range of RWPT in normal male and female are 19.91 ~ 39.55 ms and 21.75 ~ 37.67 ms, respectively. Compared with the female, the male had a significantly longer RWPT at lead II (29.73 ± 5.01 ms vs 29.71 ± 4.06 ms in female, P = 0.000). CONCLUSION: Our study showed that RWPT at lead II is different between male and female. The male had a significantly longer RWPT at lead II than the female. BioMed Central 2016-05-10 /pmc/articles/PMC4862132/ /pubmed/27165698 http://dx.doi.org/10.1186/s12872-016-0258-7 Text en © Deng et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Deng, Jinhua Chen, Tingting Zeng, Chujuan Lu, Nan Zhou, Lihong Tan, Xuerui Yu, Min R-wave peak time at lead II in Chinese healthy adults |
title | R-wave peak time at lead II in Chinese healthy adults |
title_full | R-wave peak time at lead II in Chinese healthy adults |
title_fullStr | R-wave peak time at lead II in Chinese healthy adults |
title_full_unstemmed | R-wave peak time at lead II in Chinese healthy adults |
title_short | R-wave peak time at lead II in Chinese healthy adults |
title_sort | r-wave peak time at lead ii in chinese healthy adults |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4862132/ https://www.ncbi.nlm.nih.gov/pubmed/27165698 http://dx.doi.org/10.1186/s12872-016-0258-7 |
work_keys_str_mv | AT dengjinhua rwavepeaktimeatleadiiinchinesehealthyadults AT chentingting rwavepeaktimeatleadiiinchinesehealthyadults AT zengchujuan rwavepeaktimeatleadiiinchinesehealthyadults AT lunan rwavepeaktimeatleadiiinchinesehealthyadults AT zhoulihong rwavepeaktimeatleadiiinchinesehealthyadults AT tanxuerui rwavepeaktimeatleadiiinchinesehealthyadults AT yumin rwavepeaktimeatleadiiinchinesehealthyadults |