Cargando…
Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers
BACKGROUND: In order to match the challenges of quickly recognizing and treating any life-threatening injuries, the ABCDE principles were established for the assessment and treatment of trauma patients. The high priority of spine protection is emphasized by the fact that immobilization of the cervic...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4867978/ https://www.ncbi.nlm.nih.gov/pubmed/27180045 http://dx.doi.org/10.1186/s13049-016-0267-7 |
_version_ | 1782432117819441152 |
---|---|
author | Kreinest, Michael Gliwitzky, Bernhard Schüler, Svenja Grützner, Paul A. Münzberg, Matthias |
author_facet | Kreinest, Michael Gliwitzky, Bernhard Schüler, Svenja Grützner, Paul A. Münzberg, Matthias |
author_sort | Kreinest, Michael |
collection | PubMed |
description | BACKGROUND: In order to match the challenges of quickly recognizing and treating any life-threatening injuries, the ABCDE principles were established for the assessment and treatment of trauma patients. The high priority of spine protection is emphasized by the fact that immobilization of the cervical spine is performed at the very first step in the ABCDE principles. Immobilization is typically performed to prevent or minimize secondary damage to the spinal cord if instability of the spinal column is suspected. Due to increasing reports about disadvantages of spinal immobilization, the indications for performing spinal immobilization must be refined. The aim of this study was (i) to develop a protocol that supports decision-making for spinal immobilization in adult trauma patients and (ii) to carry out the first applicability test by emergency medical personnel. METHODS: A structured literature search considering the literature from 1980 to 2014 was performed. Based on this literature and on the current guidelines, a new protocol that supports on scene decision-making for spinal immobilization has been developed. Parameters found in the literature concerning mechanisms and factors increasing the likelihood of spinal injury have been included in the new protocol. In order to test the applicability of the new protocol two surveys were performed on German emergency care providers by means of a questionnaire focused on correct decision-making if applying the protocol. RESULTS: Based on the current literature and guidelines, the Emergency Medicine Spinal Immobilization Protocol (E.M.S. IMMO Protocol) for adult trauma patients was developed. Following a fist applicability test involving 21 participants, the first version of the E.M.S. IMMO Protocol has to be graphically re-organized. A second applicability test comprised 50 participants with the current version of the protocol confirmed good applicability. Questions regarding immobilization of trauma patients could be answered properly using the E.M.S. IMMO Protocol. DISCUSSION: Current literature increasingly reports of disadvantages that may be associated with immobilization. Based on the requirements of the current guidelines, a new protocol that supports decision-making for indications for out-of-hospital spinal immobilization has been developed in this study. In contrast to established protocols, the new protocol offers different options for immobilization as well as a decicion-support. CONCLUSIONS: The E.M.S. IMMO protocol provides a decision-support tool for indications for spinal immobilization in adult trauma patients that permits variable decision-making depending on the current condition of the trauma patient and the pattern of injuries for immobilization in general and for immobilization method in particular. |
format | Online Article Text |
id | pubmed-4867978 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-48679782016-05-17 Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers Kreinest, Michael Gliwitzky, Bernhard Schüler, Svenja Grützner, Paul A. Münzberg, Matthias Scand J Trauma Resusc Emerg Med Original Research BACKGROUND: In order to match the challenges of quickly recognizing and treating any life-threatening injuries, the ABCDE principles were established for the assessment and treatment of trauma patients. The high priority of spine protection is emphasized by the fact that immobilization of the cervical spine is performed at the very first step in the ABCDE principles. Immobilization is typically performed to prevent or minimize secondary damage to the spinal cord if instability of the spinal column is suspected. Due to increasing reports about disadvantages of spinal immobilization, the indications for performing spinal immobilization must be refined. The aim of this study was (i) to develop a protocol that supports decision-making for spinal immobilization in adult trauma patients and (ii) to carry out the first applicability test by emergency medical personnel. METHODS: A structured literature search considering the literature from 1980 to 2014 was performed. Based on this literature and on the current guidelines, a new protocol that supports on scene decision-making for spinal immobilization has been developed. Parameters found in the literature concerning mechanisms and factors increasing the likelihood of spinal injury have been included in the new protocol. In order to test the applicability of the new protocol two surveys were performed on German emergency care providers by means of a questionnaire focused on correct decision-making if applying the protocol. RESULTS: Based on the current literature and guidelines, the Emergency Medicine Spinal Immobilization Protocol (E.M.S. IMMO Protocol) for adult trauma patients was developed. Following a fist applicability test involving 21 participants, the first version of the E.M.S. IMMO Protocol has to be graphically re-organized. A second applicability test comprised 50 participants with the current version of the protocol confirmed good applicability. Questions regarding immobilization of trauma patients could be answered properly using the E.M.S. IMMO Protocol. DISCUSSION: Current literature increasingly reports of disadvantages that may be associated with immobilization. Based on the requirements of the current guidelines, a new protocol that supports decision-making for indications for out-of-hospital spinal immobilization has been developed in this study. In contrast to established protocols, the new protocol offers different options for immobilization as well as a decicion-support. CONCLUSIONS: The E.M.S. IMMO protocol provides a decision-support tool for indications for spinal immobilization in adult trauma patients that permits variable decision-making depending on the current condition of the trauma patient and the pattern of injuries for immobilization in general and for immobilization method in particular. BioMed Central 2016-05-14 /pmc/articles/PMC4867978/ /pubmed/27180045 http://dx.doi.org/10.1186/s13049-016-0267-7 Text en © Kreinest et al. 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Original Research Kreinest, Michael Gliwitzky, Bernhard Schüler, Svenja Grützner, Paul A. Münzberg, Matthias Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title | Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title_full | Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title_fullStr | Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title_full_unstemmed | Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title_short | Development of a new Emergency Medicine Spinal Immobilization Protocol for trauma patients and a test of applicability by German emergency care providers |
title_sort | development of a new emergency medicine spinal immobilization protocol for trauma patients and a test of applicability by german emergency care providers |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4867978/ https://www.ncbi.nlm.nih.gov/pubmed/27180045 http://dx.doi.org/10.1186/s13049-016-0267-7 |
work_keys_str_mv | AT kreinestmichael developmentofanewemergencymedicinespinalimmobilizationprotocolfortraumapatientsandatestofapplicabilitybygermanemergencycareproviders AT gliwitzkybernhard developmentofanewemergencymedicinespinalimmobilizationprotocolfortraumapatientsandatestofapplicabilitybygermanemergencycareproviders AT schulersvenja developmentofanewemergencymedicinespinalimmobilizationprotocolfortraumapatientsandatestofapplicabilitybygermanemergencycareproviders AT grutznerpaula developmentofanewemergencymedicinespinalimmobilizationprotocolfortraumapatientsandatestofapplicabilitybygermanemergencycareproviders AT munzbergmatthias developmentofanewemergencymedicinespinalimmobilizationprotocolfortraumapatientsandatestofapplicabilitybygermanemergencycareproviders |