Cargando…

Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection

As one of the Ca(2+) sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and st...

Descripción completa

Detalles Bibliográficos
Autores principales: Wei, Menghan, Wang, Sanhong, Dong, Hui, Cai, Binhua, Tao, Jianmin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4871508/
https://www.ncbi.nlm.nih.gov/pubmed/27186637
http://dx.doi.org/10.1371/journal.pone.0155590
_version_ 1782432607093391360
author Wei, Menghan
Wang, Sanhong
Dong, Hui
Cai, Binhua
Tao, Jianmin
author_facet Wei, Menghan
Wang, Sanhong
Dong, Hui
Cai, Binhua
Tao, Jianmin
author_sort Wei, Menghan
collection PubMed
description As one of the Ca(2+) sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and strawberry (Fragaria vesca) in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD) or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA]), while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA). Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR). Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae.
format Online
Article
Text
id pubmed-4871508
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-48715082016-05-31 Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection Wei, Menghan Wang, Sanhong Dong, Hui Cai, Binhua Tao, Jianmin PLoS One Research Article As one of the Ca(2+) sensors, calcium-dependent protein kinase (CPK) plays vital roles in immune and stress signaling, growth and development, and hormone responses, etc. Recently, the whole genome of apple (Malus × domestica), pear (Pyrus communis), peach (Prunus persica), plum (Prunus mume) and strawberry (Fragaria vesca) in Rosaceae family has been fully sequenced. However, little is known about the CPK gene family in these Rosaceae species. In this study, 123 CPK genes were identified from five Rosaceae species, including 37 apple CPKs, 37 pear CPKs, 17 peach CPKs, 16 strawberry CPKs, and 16 plum CPKs. Based on the phylogenetic tree topology and structural characteristics, we divided the CPK gene family into 4 distinct subfamilies: Group I, II, III, and IV. Whole-genome duplication (WGD) or segmental duplication played vital roles in the expansion of the CPK in these Rosaceae species. Most of segmental duplication pairs in peach and plum may have arisen from the γ triplication (~140 million years ago [MYA]), while in apple genome, many duplicated genes may have been derived from a recent WGD (30~45 MYA). Purifying selection also played a critical role in the function evolution of CPK family genes. Expression of apple CPK genes in response to apple pathotype of Alternaria alternata was verified by analysis of quantitative real-time RT-PCR (qPCR). Expression data demonstrated that CPK genes in apple might have evolved independently in different biological contexts. The analysis of evolution history and expression profile laid a foundation for further examining the function and complexity of the CPK gene family in Rosaceae. Public Library of Science 2016-05-17 /pmc/articles/PMC4871508/ /pubmed/27186637 http://dx.doi.org/10.1371/journal.pone.0155590 Text en © 2016 Wei et al http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/) , which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Article
Wei, Menghan
Wang, Sanhong
Dong, Hui
Cai, Binhua
Tao, Jianmin
Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title_full Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title_fullStr Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title_full_unstemmed Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title_short Characterization and Comparison of the CPK Gene Family in the Apple (Malus × domestica) and Other Rosaceae Species and Its Response to Alternaria alternata Infection
title_sort characterization and comparison of the cpk gene family in the apple (malus × domestica) and other rosaceae species and its response to alternaria alternata infection
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4871508/
https://www.ncbi.nlm.nih.gov/pubmed/27186637
http://dx.doi.org/10.1371/journal.pone.0155590
work_keys_str_mv AT weimenghan characterizationandcomparisonofthecpkgenefamilyintheapplemalusdomesticaandotherrosaceaespeciesanditsresponsetoalternariaalternatainfection
AT wangsanhong characterizationandcomparisonofthecpkgenefamilyintheapplemalusdomesticaandotherrosaceaespeciesanditsresponsetoalternariaalternatainfection
AT donghui characterizationandcomparisonofthecpkgenefamilyintheapplemalusdomesticaandotherrosaceaespeciesanditsresponsetoalternariaalternatainfection
AT caibinhua characterizationandcomparisonofthecpkgenefamilyintheapplemalusdomesticaandotherrosaceaespeciesanditsresponsetoalternariaalternatainfection
AT taojianmin characterizationandcomparisonofthecpkgenefamilyintheapplemalusdomesticaandotherrosaceaespeciesanditsresponsetoalternariaalternatainfection