Cargando…
An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-thr...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4880943/ https://www.ncbi.nlm.nih.gov/pubmed/27225429 http://dx.doi.org/10.1038/srep26693 |
_version_ | 1782433877752545280 |
---|---|
author | Peng, Wenzhu Xu, Jian Zhang, Yan Feng, Jianxin Dong, Chuanju Jiang, Likun Feng, Jingyan Chen, Baohua Gong, Yiwen Chen, Lin Xu, Peng |
author_facet | Peng, Wenzhu Xu, Jian Zhang, Yan Feng, Jianxin Dong, Chuanju Jiang, Likun Feng, Jingyan Chen, Baohua Gong, Yiwen Chen, Lin Xu, Peng |
author_sort | Peng, Wenzhu |
collection | PubMed |
description | High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-throughput genotyping with the carp 250 K single nucleotide polymorphism (SNP) array in a mapping family. The genetic length of the consensus map was 10,595.94 cM with an average locus interval of 0.75 cM and an average marker interval of 0.38 cM. Comparative genomic analysis revealed high level of conserved syntenies between common carp and the closely related model species zebrafish and medaka. The genome scaffolds were anchored to the high-density linkage map, spanning 1,357 Mb of common carp reference genome. QTL mapping and association analysis identified 22 QTLs for growth-related traits and 7 QTLs for sex dimorphism. Candidate genes underlying growth-related traits were identified, including important regulators such as KISS2, IGF1, SMTLB, NPFFR1 and CPE. Candidate genes associated with sex dimorphism were also identified including 3KSR and DMRT2b. The high-density and high-resolution genetic linkage map provides an important tool for QTL fine mapping and positional cloning of economically important traits, and improving common carp genome assembly. |
format | Online Article Text |
id | pubmed-4880943 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Nature Publishing Group |
record_format | MEDLINE/PubMed |
spelling | pubmed-48809432016-06-07 An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) Peng, Wenzhu Xu, Jian Zhang, Yan Feng, Jianxin Dong, Chuanju Jiang, Likun Feng, Jingyan Chen, Baohua Gong, Yiwen Chen, Lin Xu, Peng Sci Rep Article High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-throughput genotyping with the carp 250 K single nucleotide polymorphism (SNP) array in a mapping family. The genetic length of the consensus map was 10,595.94 cM with an average locus interval of 0.75 cM and an average marker interval of 0.38 cM. Comparative genomic analysis revealed high level of conserved syntenies between common carp and the closely related model species zebrafish and medaka. The genome scaffolds were anchored to the high-density linkage map, spanning 1,357 Mb of common carp reference genome. QTL mapping and association analysis identified 22 QTLs for growth-related traits and 7 QTLs for sex dimorphism. Candidate genes underlying growth-related traits were identified, including important regulators such as KISS2, IGF1, SMTLB, NPFFR1 and CPE. Candidate genes associated with sex dimorphism were also identified including 3KSR and DMRT2b. The high-density and high-resolution genetic linkage map provides an important tool for QTL fine mapping and positional cloning of economically important traits, and improving common carp genome assembly. Nature Publishing Group 2016-05-26 /pmc/articles/PMC4880943/ /pubmed/27225429 http://dx.doi.org/10.1038/srep26693 Text en Copyright © 2016, Macmillan Publishers Limited http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Article Peng, Wenzhu Xu, Jian Zhang, Yan Feng, Jianxin Dong, Chuanju Jiang, Likun Feng, Jingyan Chen, Baohua Gong, Yiwen Chen, Lin Xu, Peng An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title | An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title_full | An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title_fullStr | An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title_full_unstemmed | An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title_short | An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) |
title_sort | ultra-high density linkage map and qtl mapping for sex and growth-related traits of common carp (cyprinus carpio) |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4880943/ https://www.ncbi.nlm.nih.gov/pubmed/27225429 http://dx.doi.org/10.1038/srep26693 |
work_keys_str_mv | AT pengwenzhu anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT xujian anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT zhangyan anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT fengjianxin anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT dongchuanju anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT jianglikun anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT fengjingyan anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT chenbaohua anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT gongyiwen anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT chenlin anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT xupeng anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT pengwenzhu ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT xujian ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT zhangyan ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT fengjianxin ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT dongchuanju ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT jianglikun ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT fengjingyan ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT chenbaohua ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT gongyiwen ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT chenlin ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio AT xupeng ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio |