Cargando…

An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)

High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-thr...

Descripción completa

Detalles Bibliográficos
Autores principales: Peng, Wenzhu, Xu, Jian, Zhang, Yan, Feng, Jianxin, Dong, Chuanju, Jiang, Likun, Feng, Jingyan, Chen, Baohua, Gong, Yiwen, Chen, Lin, Xu, Peng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4880943/
https://www.ncbi.nlm.nih.gov/pubmed/27225429
http://dx.doi.org/10.1038/srep26693
_version_ 1782433877752545280
author Peng, Wenzhu
Xu, Jian
Zhang, Yan
Feng, Jianxin
Dong, Chuanju
Jiang, Likun
Feng, Jingyan
Chen, Baohua
Gong, Yiwen
Chen, Lin
Xu, Peng
author_facet Peng, Wenzhu
Xu, Jian
Zhang, Yan
Feng, Jianxin
Dong, Chuanju
Jiang, Likun
Feng, Jingyan
Chen, Baohua
Gong, Yiwen
Chen, Lin
Xu, Peng
author_sort Peng, Wenzhu
collection PubMed
description High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-throughput genotyping with the carp 250 K single nucleotide polymorphism (SNP) array in a mapping family. The genetic length of the consensus map was 10,595.94 cM with an average locus interval of 0.75 cM and an average marker interval of 0.38 cM. Comparative genomic analysis revealed high level of conserved syntenies between common carp and the closely related model species zebrafish and medaka. The genome scaffolds were anchored to the high-density linkage map, spanning 1,357 Mb of common carp reference genome. QTL mapping and association analysis identified 22 QTLs for growth-related traits and 7 QTLs for sex dimorphism. Candidate genes underlying growth-related traits were identified, including important regulators such as KISS2, IGF1, SMTLB, NPFFR1 and CPE. Candidate genes associated with sex dimorphism were also identified including 3KSR and DMRT2b. The high-density and high-resolution genetic linkage map provides an important tool for QTL fine mapping and positional cloning of economically important traits, and improving common carp genome assembly.
format Online
Article
Text
id pubmed-4880943
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Nature Publishing Group
record_format MEDLINE/PubMed
spelling pubmed-48809432016-06-07 An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio) Peng, Wenzhu Xu, Jian Zhang, Yan Feng, Jianxin Dong, Chuanju Jiang, Likun Feng, Jingyan Chen, Baohua Gong, Yiwen Chen, Lin Xu, Peng Sci Rep Article High density genetic linkage maps are essential for QTL fine mapping, comparative genomics and high quality genome sequence assembly. In this study, we constructed a high-density and high-resolution genetic linkage map with 28,194 SNP markers on 14,146 distinct loci for common carp based on high-throughput genotyping with the carp 250 K single nucleotide polymorphism (SNP) array in a mapping family. The genetic length of the consensus map was 10,595.94 cM with an average locus interval of 0.75 cM and an average marker interval of 0.38 cM. Comparative genomic analysis revealed high level of conserved syntenies between common carp and the closely related model species zebrafish and medaka. The genome scaffolds were anchored to the high-density linkage map, spanning 1,357 Mb of common carp reference genome. QTL mapping and association analysis identified 22 QTLs for growth-related traits and 7 QTLs for sex dimorphism. Candidate genes underlying growth-related traits were identified, including important regulators such as KISS2, IGF1, SMTLB, NPFFR1 and CPE. Candidate genes associated with sex dimorphism were also identified including 3KSR and DMRT2b. The high-density and high-resolution genetic linkage map provides an important tool for QTL fine mapping and positional cloning of economically important traits, and improving common carp genome assembly. Nature Publishing Group 2016-05-26 /pmc/articles/PMC4880943/ /pubmed/27225429 http://dx.doi.org/10.1038/srep26693 Text en Copyright © 2016, Macmillan Publishers Limited http://creativecommons.org/licenses/by/4.0/ This work is licensed under a Creative Commons Attribution 4.0 International License. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in the credit line; if the material is not included under the Creative Commons license, users will need to obtain permission from the license holder to reproduce the material. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/
spellingShingle Article
Peng, Wenzhu
Xu, Jian
Zhang, Yan
Feng, Jianxin
Dong, Chuanju
Jiang, Likun
Feng, Jingyan
Chen, Baohua
Gong, Yiwen
Chen, Lin
Xu, Peng
An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title_full An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title_fullStr An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title_full_unstemmed An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title_short An ultra-high density linkage map and QTL mapping for sex and growth-related traits of common carp (Cyprinus carpio)
title_sort ultra-high density linkage map and qtl mapping for sex and growth-related traits of common carp (cyprinus carpio)
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4880943/
https://www.ncbi.nlm.nih.gov/pubmed/27225429
http://dx.doi.org/10.1038/srep26693
work_keys_str_mv AT pengwenzhu anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT xujian anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT zhangyan anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT fengjianxin anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT dongchuanju anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT jianglikun anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT fengjingyan anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT chenbaohua anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT gongyiwen anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT chenlin anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT xupeng anultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT pengwenzhu ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT xujian ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT zhangyan ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT fengjianxin ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT dongchuanju ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT jianglikun ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT fengjingyan ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT chenbaohua ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT gongyiwen ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT chenlin ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio
AT xupeng ultrahighdensitylinkagemapandqtlmappingforsexandgrowthrelatedtraitsofcommoncarpcyprinuscarpio