Cargando…
GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
Glycine serves as a major source of single carbon units for biochemical reactions within bacterial cells. Utilization of glycine is tightly regulated and revolves around a key group of proteins known as the glycine cleavage system (GCS). Our lab previously identified the transcriptional regulator Gc...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society for Microbiology
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4894688/ https://www.ncbi.nlm.nih.gov/pubmed/27303730 http://dx.doi.org/10.1128/mSphere.00020-16 |
_version_ | 1782435710457872384 |
---|---|
author | Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. |
author_facet | Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. |
author_sort | Sarwar, Zaara |
collection | PubMed |
description | Glycine serves as a major source of single carbon units for biochemical reactions within bacterial cells. Utilization of glycine is tightly regulated and revolves around a key group of proteins known as the glycine cleavage system (GCS). Our lab previously identified the transcriptional regulator GcsR (PA2449) as being required for catabolism of glycine in the opportunistic pathogen Pseudomonas aeruginosa PAO1. In an effort to clarify and have an overall better understanding of the role of GcsR in glycine metabolism, a combination of transcriptome sequencing and electrophoretic mobility shift assays was used to identify target genes of this transcriptional regulator. It was found that GcsR binds to an 18-bp consensus sequence (TGTAACG-N(4)-CGTTCCG) upstream of the gcs2 operon, consisting of the gcvH2, gcvP2, glyA2, sdaA, and gcvT2 genes. The proteins encoded by these genes, namely, the GCS (GcvH2-GcvP2-GcvT2), serine hydroxymethyltransferase (GlyA2), and serine dehydratase (SdaA), form a metabolic pathway for the conversion of glycine into pyruvate, which can enter the central metabolism. GcsR activates transcription of the gcs2 operon in response to glycine. Interestingly, GcsR belongs to a family of transcriptional regulators known as TyrR-like enhancer-binding proteins (EBPs). Until this study, TyrR-like EBPs were only known to function in regulating aromatic amino acid metabolism. GcsR is the founding member of a new class of TyrR-like EBPs that function in the regulation of glycine metabolism. Indeed, homologs of GcsR and its target genes are present in almost all sequenced genomes of the Pseudomonadales order, suggesting that this genetic regulatory mechanism is a common theme for pseudomonads. IMPORTANCE Glycine is required for various cellular functions, including cell wall synthesis, protein synthesis, and the biosynthesis of several important metabolites. Regulating levels of glycine metabolism allows P. aeruginosa to maintain the metabolic flux of glycine through several pathways, including the metabolism of glycine to produce other amino acids, entry into the trichloroacetic acid cycle, and the production of virulence factors such as hydrogen cyanide. In this study, we characterized GcsR, a transcriptional regulator that activates the expression of genes involved in P. aeruginosa PAO1 glycine metabolism. Our work reveals that GcsR is the founding member of a novel class of TyrR-like EBPs that likely regulate glycine metabolism in Pseudomonadales. |
format | Online Article Text |
id | pubmed-4894688 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | American Society for Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-48946882016-06-14 GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. mSphere Research Article Glycine serves as a major source of single carbon units for biochemical reactions within bacterial cells. Utilization of glycine is tightly regulated and revolves around a key group of proteins known as the glycine cleavage system (GCS). Our lab previously identified the transcriptional regulator GcsR (PA2449) as being required for catabolism of glycine in the opportunistic pathogen Pseudomonas aeruginosa PAO1. In an effort to clarify and have an overall better understanding of the role of GcsR in glycine metabolism, a combination of transcriptome sequencing and electrophoretic mobility shift assays was used to identify target genes of this transcriptional regulator. It was found that GcsR binds to an 18-bp consensus sequence (TGTAACG-N(4)-CGTTCCG) upstream of the gcs2 operon, consisting of the gcvH2, gcvP2, glyA2, sdaA, and gcvT2 genes. The proteins encoded by these genes, namely, the GCS (GcvH2-GcvP2-GcvT2), serine hydroxymethyltransferase (GlyA2), and serine dehydratase (SdaA), form a metabolic pathway for the conversion of glycine into pyruvate, which can enter the central metabolism. GcsR activates transcription of the gcs2 operon in response to glycine. Interestingly, GcsR belongs to a family of transcriptional regulators known as TyrR-like enhancer-binding proteins (EBPs). Until this study, TyrR-like EBPs were only known to function in regulating aromatic amino acid metabolism. GcsR is the founding member of a new class of TyrR-like EBPs that function in the regulation of glycine metabolism. Indeed, homologs of GcsR and its target genes are present in almost all sequenced genomes of the Pseudomonadales order, suggesting that this genetic regulatory mechanism is a common theme for pseudomonads. IMPORTANCE Glycine is required for various cellular functions, including cell wall synthesis, protein synthesis, and the biosynthesis of several important metabolites. Regulating levels of glycine metabolism allows P. aeruginosa to maintain the metabolic flux of glycine through several pathways, including the metabolism of glycine to produce other amino acids, entry into the trichloroacetic acid cycle, and the production of virulence factors such as hydrogen cyanide. In this study, we characterized GcsR, a transcriptional regulator that activates the expression of genes involved in P. aeruginosa PAO1 glycine metabolism. Our work reveals that GcsR is the founding member of a novel class of TyrR-like EBPs that likely regulate glycine metabolism in Pseudomonadales. American Society for Microbiology 2016-04-27 /pmc/articles/PMC4894688/ /pubmed/27303730 http://dx.doi.org/10.1128/mSphere.00020-16 Text en Copyright © 2016 Sarwar et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (http://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Research Article Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title | GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title_full | GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title_fullStr | GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title_full_unstemmed | GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title_short | GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
title_sort | gcsr, a tyrr-like enhancer-binding protein, regulates expression of the glycine cleavage system in pseudomonas aeruginosa pao1 |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4894688/ https://www.ncbi.nlm.nih.gov/pubmed/27303730 http://dx.doi.org/10.1128/mSphere.00020-16 |
work_keys_str_mv | AT sarwarzaara gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT lundgrenbenjaminr gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT grassamichaelt gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT wangmichaelx gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT gribblemegan gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT moffatjenniferf gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT nomurachristophert gcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 |