Cargando…

Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review

BACKGROUND: Gastrointestinal and respiratory diseases in calves and piglets lead to significant economic losses in livestock husbandry. A high morbidity has been reported for diarrhea (calves ≤ 35 %; piglets ≤ 50 %) and for respiratory diseases (calves ≤ 80 %; piglets ≤ 40 %). Despite a highly diver...

Descripción completa

Detalles Bibliográficos
Autores principales: Ayrle, Hannah, Mevissen, Meike, Kaske, Martin, Nathues, Heiko, Gruetzner, Niels, Melzig, Matthias, Walkenhorst, Michael
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4896019/
https://www.ncbi.nlm.nih.gov/pubmed/27268043
http://dx.doi.org/10.1186/s12917-016-0714-8
_version_ 1782435970737504256
author Ayrle, Hannah
Mevissen, Meike
Kaske, Martin
Nathues, Heiko
Gruetzner, Niels
Melzig, Matthias
Walkenhorst, Michael
author_facet Ayrle, Hannah
Mevissen, Meike
Kaske, Martin
Nathues, Heiko
Gruetzner, Niels
Melzig, Matthias
Walkenhorst, Michael
author_sort Ayrle, Hannah
collection PubMed
description BACKGROUND: Gastrointestinal and respiratory diseases in calves and piglets lead to significant economic losses in livestock husbandry. A high morbidity has been reported for diarrhea (calves ≤ 35 %; piglets ≤ 50 %) and for respiratory diseases (calves ≤ 80 %; piglets ≤ 40 %). Despite a highly diverse etiology and pathophysiology of these diseases, treatment with antimicrobials is often the first-line therapy. Multi-antimicrobial resistance in pathogens results in international accordance to strengthen the research in novel treatment options. Medicinal plants bear a potential as alternative or additional treatment. Based on the versatile effects of their plant specific multi-component-compositions, medicinal plants can potentially act as ‘multi-target drugs’. Regarding the plurality of medicinal plants, the aim of this systematic review was to identify potential medicinal plant species for prevention and treatment of gastrointestinal and respiratory diseases and for modulation of the immune system and inflammation in calves and piglets. RESULTS: Based on nine initial sources including standard textbooks and European ethnoveterinary studies, a total of 223 medicinal plant species related to the treatment of gastrointestinal and respiratory diseases was identified. A defined search strategy was established using the PRISMA statement to evaluate 30 medicinal plant species starting from 20’000 peer-reviewed articles published in the last 20 years (1994–2014). This strategy led to 418 references (257 in vitro, 84 in vivo and 77 clinical trials, thereof 48 clinical trials in veterinary medicine) to evaluate effects of medicinal plants and their efficacy in detail. The findings indicate that the most promising candidates for gastrointestinal diseases are Allium sativum L., Mentha x piperita L. and Salvia officinalis L.; for diseases of the respiratory tract Echinacea purpurea (L.) MOENCH, Thymus vulgaris L. and Althea officinalis L. were found most promising, and Echinacea purpurea (L.) MOENCH, Camellia sinensis (L.) KUNTZE, Glycyrrhiza glabra L. and Origanum vulgare L. were identified as best candidates for modulation of the immune system and inflammation. CONCLUSIONS: Several medicinal plants bear a potential for novel treatment strategies for young livestock. There is a need for further research focused on gastrointestinal and respiratory diseases in calves and piglets, and the findings of this review provide a basis on plant selection for future studies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-016-0714-8) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4896019
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-48960192016-06-08 Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review Ayrle, Hannah Mevissen, Meike Kaske, Martin Nathues, Heiko Gruetzner, Niels Melzig, Matthias Walkenhorst, Michael BMC Vet Res Research Article BACKGROUND: Gastrointestinal and respiratory diseases in calves and piglets lead to significant economic losses in livestock husbandry. A high morbidity has been reported for diarrhea (calves ≤ 35 %; piglets ≤ 50 %) and for respiratory diseases (calves ≤ 80 %; piglets ≤ 40 %). Despite a highly diverse etiology and pathophysiology of these diseases, treatment with antimicrobials is often the first-line therapy. Multi-antimicrobial resistance in pathogens results in international accordance to strengthen the research in novel treatment options. Medicinal plants bear a potential as alternative or additional treatment. Based on the versatile effects of their plant specific multi-component-compositions, medicinal plants can potentially act as ‘multi-target drugs’. Regarding the plurality of medicinal plants, the aim of this systematic review was to identify potential medicinal plant species for prevention and treatment of gastrointestinal and respiratory diseases and for modulation of the immune system and inflammation in calves and piglets. RESULTS: Based on nine initial sources including standard textbooks and European ethnoveterinary studies, a total of 223 medicinal plant species related to the treatment of gastrointestinal and respiratory diseases was identified. A defined search strategy was established using the PRISMA statement to evaluate 30 medicinal plant species starting from 20’000 peer-reviewed articles published in the last 20 years (1994–2014). This strategy led to 418 references (257 in vitro, 84 in vivo and 77 clinical trials, thereof 48 clinical trials in veterinary medicine) to evaluate effects of medicinal plants and their efficacy in detail. The findings indicate that the most promising candidates for gastrointestinal diseases are Allium sativum L., Mentha x piperita L. and Salvia officinalis L.; for diseases of the respiratory tract Echinacea purpurea (L.) MOENCH, Thymus vulgaris L. and Althea officinalis L. were found most promising, and Echinacea purpurea (L.) MOENCH, Camellia sinensis (L.) KUNTZE, Glycyrrhiza glabra L. and Origanum vulgare L. were identified as best candidates for modulation of the immune system and inflammation. CONCLUSIONS: Several medicinal plants bear a potential for novel treatment strategies for young livestock. There is a need for further research focused on gastrointestinal and respiratory diseases in calves and piglets, and the findings of this review provide a basis on plant selection for future studies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12917-016-0714-8) contains supplementary material, which is available to authorized users. BioMed Central 2016-06-06 /pmc/articles/PMC4896019/ /pubmed/27268043 http://dx.doi.org/10.1186/s12917-016-0714-8 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Ayrle, Hannah
Mevissen, Meike
Kaske, Martin
Nathues, Heiko
Gruetzner, Niels
Melzig, Matthias
Walkenhorst, Michael
Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title_full Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title_fullStr Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title_full_unstemmed Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title_short Medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? A systematic review
title_sort medicinal plants – prophylactic and therapeutic options for gastrointestinal and respiratory diseases in calves and piglets? a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4896019/
https://www.ncbi.nlm.nih.gov/pubmed/27268043
http://dx.doi.org/10.1186/s12917-016-0714-8
work_keys_str_mv AT ayrlehannah medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT mevissenmeike medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT kaskemartin medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT nathuesheiko medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT gruetznerniels medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT melzigmatthias medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview
AT walkenhorstmichael medicinalplantsprophylacticandtherapeuticoptionsforgastrointestinalandrespiratorydiseasesincalvesandpigletsasystematicreview