Cargando…
Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevate...
Autores principales: | , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2015
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4899571/ https://www.ncbi.nlm.nih.gov/pubmed/27330600 http://dx.doi.org/10.2484/rcr.v7i4.755 |
_version_ | 1782436484879482880 |
---|---|
author | Mehta, Nimisha Calhoun, Sean K. |
author_facet | Mehta, Nimisha Calhoun, Sean K. |
author_sort | Mehta, Nimisha |
collection | PubMed |
description | Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevated serum IgG4 levels, extensive IgG4-positive plasma cells, and lymphocyte infiltration of the affected organs. We describe the clinical and radiographic presentation and pathologic findings in a patient with isolated renal involvement in IgG4-related sclerosing disease. |
format | Online Article Text |
id | pubmed-4899571 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2015 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-48995712016-06-18 Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy Mehta, Nimisha Calhoun, Sean K. Radiol Case Rep Article Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevated serum IgG4 levels, extensive IgG4-positive plasma cells, and lymphocyte infiltration of the affected organs. We describe the clinical and radiographic presentation and pathologic findings in a patient with isolated renal involvement in IgG4-related sclerosing disease. Elsevier 2015-12-07 /pmc/articles/PMC4899571/ /pubmed/27330600 http://dx.doi.org/10.2484/rcr.v7i4.755 Text en © 2012 The Authors. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Article Mehta, Nimisha Calhoun, Sean K. Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title | Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title_full | Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title_fullStr | Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title_full_unstemmed | Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title_short | Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
title_sort | immunoglobulin g4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4899571/ https://www.ncbi.nlm.nih.gov/pubmed/27330600 http://dx.doi.org/10.2484/rcr.v7i4.755 |
work_keys_str_mv | AT mehtanimisha immunoglobuling4relatedsclerosingdiseasepresentingasararecauseofrenalpelvicmassmimickingmalignancy AT calhounseank immunoglobuling4relatedsclerosingdiseasepresentingasararecauseofrenalpelvicmassmimickingmalignancy |