Cargando…

Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy

Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevate...

Descripción completa

Detalles Bibliográficos
Autores principales: Mehta, Nimisha, Calhoun, Sean K.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2015
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4899571/
https://www.ncbi.nlm.nih.gov/pubmed/27330600
http://dx.doi.org/10.2484/rcr.v7i4.755
_version_ 1782436484879482880
author Mehta, Nimisha
Calhoun, Sean K.
author_facet Mehta, Nimisha
Calhoun, Sean K.
author_sort Mehta, Nimisha
collection PubMed
description Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevated serum IgG4 levels, extensive IgG4-positive plasma cells, and lymphocyte infiltration of the affected organs. We describe the clinical and radiographic presentation and pathologic findings in a patient with isolated renal involvement in IgG4-related sclerosing disease.
format Online
Article
Text
id pubmed-4899571
institution National Center for Biotechnology Information
language English
publishDate 2015
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-48995712016-06-18 Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy Mehta, Nimisha Calhoun, Sean K. Radiol Case Rep Article Immunoglobulin G4-related sclerosing disease is a recently recognized disease entity most commonly associated with autoimmune pancreatitis. This condition can also manifest as extra-pancreatic disease involving the bile ducts, kidney, lung, and retroperitoneum. The disease entity consists of elevated serum IgG4 levels, extensive IgG4-positive plasma cells, and lymphocyte infiltration of the affected organs. We describe the clinical and radiographic presentation and pathologic findings in a patient with isolated renal involvement in IgG4-related sclerosing disease. Elsevier 2015-12-07 /pmc/articles/PMC4899571/ /pubmed/27330600 http://dx.doi.org/10.2484/rcr.v7i4.755 Text en © 2012 The Authors. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Article
Mehta, Nimisha
Calhoun, Sean K.
Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title_full Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title_fullStr Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title_full_unstemmed Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title_short Immunoglobulin G4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
title_sort immunoglobulin g4-related sclerosing disease presenting as a rare cause of renal pelvic mass mimicking malignancy
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4899571/
https://www.ncbi.nlm.nih.gov/pubmed/27330600
http://dx.doi.org/10.2484/rcr.v7i4.755
work_keys_str_mv AT mehtanimisha immunoglobuling4relatedsclerosingdiseasepresentingasararecauseofrenalpelvicmassmimickingmalignancy
AT calhounseank immunoglobuling4relatedsclerosingdiseasepresentingasararecauseofrenalpelvicmassmimickingmalignancy