Cargando…
Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with th...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917702/ https://www.ncbi.nlm.nih.gov/pubmed/27379195 http://dx.doi.org/10.1155/2016/3478746 |
_version_ | 1782438982033866752 |
---|---|
author | Silva-Hidalgo, Gabriela López-Valenzuela, Martin Cárcamo-Aréchiga, Nora Cota-Guajardo, Silvia López-Salazar, Mayra Montiel-Vázquez, Edith |
author_facet | Silva-Hidalgo, Gabriela López-Valenzuela, Martin Cárcamo-Aréchiga, Nora Cota-Guajardo, Silvia López-Salazar, Mayra Montiel-Vázquez, Edith |
author_sort | Silva-Hidalgo, Gabriela |
collection | PubMed |
description | bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan's Zoo and Mazatlán's Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased. |
format | Online Article Text |
id | pubmed-4917702 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-49177022016-07-04 Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico Silva-Hidalgo, Gabriela López-Valenzuela, Martin Cárcamo-Aréchiga, Nora Cota-Guajardo, Silvia López-Salazar, Mayra Montiel-Vázquez, Edith Vet Med Int Research Article bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan's Zoo and Mazatlán's Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased. Hindawi Publishing Corporation 2016 2016-06-09 /pmc/articles/PMC4917702/ /pubmed/27379195 http://dx.doi.org/10.1155/2016/3478746 Text en Copyright © 2016 Gabriela Silva-Hidalgo et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Silva-Hidalgo, Gabriela López-Valenzuela, Martin Cárcamo-Aréchiga, Nora Cota-Guajardo, Silvia López-Salazar, Mayra Montiel-Vázquez, Edith Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title_full | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title_fullStr | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title_full_unstemmed | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title_short | Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico |
title_sort | identification of bapa in strains of salmonella enterica subsp. enterica isolated from wild animals kept in captivity in sinaloa, mexico |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917702/ https://www.ncbi.nlm.nih.gov/pubmed/27379195 http://dx.doi.org/10.1155/2016/3478746 |
work_keys_str_mv | AT silvahidalgogabriela identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT lopezvalenzuelamartin identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT carcamoarechiganora identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT cotaguajardosilvia identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT lopezsalazarmayra identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico AT montielvazquezedith identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico |