Cargando…

Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico

bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with th...

Descripción completa

Detalles Bibliográficos
Autores principales: Silva-Hidalgo, Gabriela, López-Valenzuela, Martin, Cárcamo-Aréchiga, Nora, Cota-Guajardo, Silvia, López-Salazar, Mayra, Montiel-Vázquez, Edith
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917702/
https://www.ncbi.nlm.nih.gov/pubmed/27379195
http://dx.doi.org/10.1155/2016/3478746
_version_ 1782438982033866752
author Silva-Hidalgo, Gabriela
López-Valenzuela, Martin
Cárcamo-Aréchiga, Nora
Cota-Guajardo, Silvia
López-Salazar, Mayra
Montiel-Vázquez, Edith
author_facet Silva-Hidalgo, Gabriela
López-Valenzuela, Martin
Cárcamo-Aréchiga, Nora
Cota-Guajardo, Silvia
López-Salazar, Mayra
Montiel-Vázquez, Edith
author_sort Silva-Hidalgo, Gabriela
collection PubMed
description bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan's Zoo and Mazatlán's Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased.
format Online
Article
Text
id pubmed-4917702
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-49177022016-07-04 Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico Silva-Hidalgo, Gabriela López-Valenzuela, Martin Cárcamo-Aréchiga, Nora Cota-Guajardo, Silvia López-Salazar, Mayra Montiel-Vázquez, Edith Vet Med Int Research Article bapA, previously named stm2689, encodes the BapA protein, which, along with cellulose and fimbriae, constitutes biofilms. Biofilms are communities of microorganisms that grow in a matrix of exopolysaccharides and may adhere to living tissues or inert surfaces. Biofilm formation is associated with the ability to persist in different environments, which contributes to the pathogenicity of several species. We analyzed the presence of bapA in 83 strains belonging to 17 serovars of Salmonella enterica subsp. enterica from wildlife in captivity at Culiacan's Zoo and Mazatlán's Aquarium. Each isolate amplified a product of 667 bp, which corresponds to the expected size of the bapA initiator, with no observed variation between different serovars analyzed. bapA gene was found to be highly conserved in Salmonella and can be targeted for the genus-specific detection of this organism from different sources. Since bapA expression improves bacterial proliferation outside of the host and facilitates resistance to disinfectants and desiccation, the survival of Salmonella in natural habitats may be favored. Thus, the risk of bacterial contamination from these animals is increased. Hindawi Publishing Corporation 2016 2016-06-09 /pmc/articles/PMC4917702/ /pubmed/27379195 http://dx.doi.org/10.1155/2016/3478746 Text en Copyright © 2016 Gabriela Silva-Hidalgo et al. https://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Article
Silva-Hidalgo, Gabriela
López-Valenzuela, Martin
Cárcamo-Aréchiga, Nora
Cota-Guajardo, Silvia
López-Salazar, Mayra
Montiel-Vázquez, Edith
Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_full Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_fullStr Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_full_unstemmed Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_short Identification of bapA in Strains of Salmonella enterica subsp. enterica Isolated from Wild Animals Kept in Captivity in Sinaloa, Mexico
title_sort identification of bapa in strains of salmonella enterica subsp. enterica isolated from wild animals kept in captivity in sinaloa, mexico
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4917702/
https://www.ncbi.nlm.nih.gov/pubmed/27379195
http://dx.doi.org/10.1155/2016/3478746
work_keys_str_mv AT silvahidalgogabriela identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT lopezvalenzuelamartin identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT carcamoarechiganora identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT cotaguajardosilvia identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT lopezsalazarmayra identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico
AT montielvazquezedith identificationofbapainstrainsofsalmonellaentericasubspentericaisolatedfromwildanimalskeptincaptivityinsinaloamexico