Cargando…
Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Impact Journals LLC
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4924669/ https://www.ncbi.nlm.nih.gov/pubmed/26872374 http://dx.doi.org/10.18632/oncotarget.7269 |
_version_ | 1782439898070908928 |
---|---|
author | Kanda, Mitsuro Shimizu, Dai Tanaka, Haruyoshi Shibata, Masahiro Iwata, Naoki Hayashi, Masamichi Kobayashi, Daisuke Tanaka, Chie Yamada, Suguru Fujii, Tsutomu Nakayama, Goro Sugimoto, Hiroyuki Koike, Masahiko Fujiwara, Michitaka Kodera, Yasuhiro |
author_facet | Kanda, Mitsuro Shimizu, Dai Tanaka, Haruyoshi Shibata, Masahiro Iwata, Naoki Hayashi, Masamichi Kobayashi, Daisuke Tanaka, Chie Yamada, Suguru Fujii, Tsutomu Nakayama, Goro Sugimoto, Hiroyuki Koike, Masahiko Fujiwara, Michitaka Kodera, Yasuhiro |
author_sort | Kanda, Mitsuro |
collection | PubMed |
description | Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic metastasis in GC. Functional and expression analyses of this molecule in GC cell lines and clinical samples were conducted. We analyzed MFSD4 expression, DNA methylation, and copy number. RNA interference experiments evaluated the effects of MFSD4 expression on cell phenotype and apoptosis. We analyzed tissues of 200 patients with GC to assess the diagnostic performance of MFSD4 levels for predicting hepatic recurrence, metastasis, or both. Differential expression of MFSD4 mRNA by GC cell lines correlated positively with the levels of NUDT13 and OCLN mRNAs and inversely with those of BMP2. Hypermethylation of the MFSD4 promoter was detected in cells with lower levels of MFSD4 mRNA. Inhibition of MFSD4 expression significantly increased the invasiveness and motility of GC cells but did not influence cell proliferation or apoptosis. MFSD4 mRNA levels in primary GC tissues were reduced in patients with concomitant hepatic metastasis or recurrence compared with those without. Low levels of MFSD4 mRNA in primary GC tissues were an independent risk factor of hepatic recurrence and metastasis. MFSD4 expression in gastric tissues may represent a useful biomarker for identification of patients at high risk for hepatic recurrence, metastasis, or both. |
format | Online Article Text |
id | pubmed-4924669 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | Impact Journals LLC |
record_format | MEDLINE/PubMed |
spelling | pubmed-49246692016-07-13 Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer Kanda, Mitsuro Shimizu, Dai Tanaka, Haruyoshi Shibata, Masahiro Iwata, Naoki Hayashi, Masamichi Kobayashi, Daisuke Tanaka, Chie Yamada, Suguru Fujii, Tsutomu Nakayama, Goro Sugimoto, Hiroyuki Koike, Masahiko Fujiwara, Michitaka Kodera, Yasuhiro Oncotarget Research Paper Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic metastasis in GC. Functional and expression analyses of this molecule in GC cell lines and clinical samples were conducted. We analyzed MFSD4 expression, DNA methylation, and copy number. RNA interference experiments evaluated the effects of MFSD4 expression on cell phenotype and apoptosis. We analyzed tissues of 200 patients with GC to assess the diagnostic performance of MFSD4 levels for predicting hepatic recurrence, metastasis, or both. Differential expression of MFSD4 mRNA by GC cell lines correlated positively with the levels of NUDT13 and OCLN mRNAs and inversely with those of BMP2. Hypermethylation of the MFSD4 promoter was detected in cells with lower levels of MFSD4 mRNA. Inhibition of MFSD4 expression significantly increased the invasiveness and motility of GC cells but did not influence cell proliferation or apoptosis. MFSD4 mRNA levels in primary GC tissues were reduced in patients with concomitant hepatic metastasis or recurrence compared with those without. Low levels of MFSD4 mRNA in primary GC tissues were an independent risk factor of hepatic recurrence and metastasis. MFSD4 expression in gastric tissues may represent a useful biomarker for identification of patients at high risk for hepatic recurrence, metastasis, or both. Impact Journals LLC 2016-02-08 /pmc/articles/PMC4924669/ /pubmed/26872374 http://dx.doi.org/10.18632/oncotarget.7269 Text en Copyright: © 2016 Kanda et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Research Paper Kanda, Mitsuro Shimizu, Dai Tanaka, Haruyoshi Shibata, Masahiro Iwata, Naoki Hayashi, Masamichi Kobayashi, Daisuke Tanaka, Chie Yamada, Suguru Fujii, Tsutomu Nakayama, Goro Sugimoto, Hiroyuki Koike, Masahiko Fujiwara, Michitaka Kodera, Yasuhiro Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title | Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title_full | Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title_fullStr | Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title_full_unstemmed | Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title_short | Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
title_sort | metastatic pathway-specific transcriptome analysis identifies mfsd4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer |
topic | Research Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4924669/ https://www.ncbi.nlm.nih.gov/pubmed/26872374 http://dx.doi.org/10.18632/oncotarget.7269 |
work_keys_str_mv | AT kandamitsuro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT shimizudai metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT tanakaharuyoshi metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT shibatamasahiro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT iwatanaoki metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT hayashimasamichi metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT kobayashidaisuke metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT tanakachie metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT yamadasuguru metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT fujiitsutomu metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT nakayamagoro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT sugimotohiroyuki metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT koikemasahiko metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT fujiwaramichitaka metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer AT koderayasuhiro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer |