Cargando…

Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer

Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic...

Descripción completa

Detalles Bibliográficos
Autores principales: Kanda, Mitsuro, Shimizu, Dai, Tanaka, Haruyoshi, Shibata, Masahiro, Iwata, Naoki, Hayashi, Masamichi, Kobayashi, Daisuke, Tanaka, Chie, Yamada, Suguru, Fujii, Tsutomu, Nakayama, Goro, Sugimoto, Hiroyuki, Koike, Masahiko, Fujiwara, Michitaka, Kodera, Yasuhiro
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Impact Journals LLC 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4924669/
https://www.ncbi.nlm.nih.gov/pubmed/26872374
http://dx.doi.org/10.18632/oncotarget.7269
_version_ 1782439898070908928
author Kanda, Mitsuro
Shimizu, Dai
Tanaka, Haruyoshi
Shibata, Masahiro
Iwata, Naoki
Hayashi, Masamichi
Kobayashi, Daisuke
Tanaka, Chie
Yamada, Suguru
Fujii, Tsutomu
Nakayama, Goro
Sugimoto, Hiroyuki
Koike, Masahiko
Fujiwara, Michitaka
Kodera, Yasuhiro
author_facet Kanda, Mitsuro
Shimizu, Dai
Tanaka, Haruyoshi
Shibata, Masahiro
Iwata, Naoki
Hayashi, Masamichi
Kobayashi, Daisuke
Tanaka, Chie
Yamada, Suguru
Fujii, Tsutomu
Nakayama, Goro
Sugimoto, Hiroyuki
Koike, Masahiko
Fujiwara, Michitaka
Kodera, Yasuhiro
author_sort Kanda, Mitsuro
collection PubMed
description Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic metastasis in GC. Functional and expression analyses of this molecule in GC cell lines and clinical samples were conducted. We analyzed MFSD4 expression, DNA methylation, and copy number. RNA interference experiments evaluated the effects of MFSD4 expression on cell phenotype and apoptosis. We analyzed tissues of 200 patients with GC to assess the diagnostic performance of MFSD4 levels for predicting hepatic recurrence, metastasis, or both. Differential expression of MFSD4 mRNA by GC cell lines correlated positively with the levels of NUDT13 and OCLN mRNAs and inversely with those of BMP2. Hypermethylation of the MFSD4 promoter was detected in cells with lower levels of MFSD4 mRNA. Inhibition of MFSD4 expression significantly increased the invasiveness and motility of GC cells but did not influence cell proliferation or apoptosis. MFSD4 mRNA levels in primary GC tissues were reduced in patients with concomitant hepatic metastasis or recurrence compared with those without. Low levels of MFSD4 mRNA in primary GC tissues were an independent risk factor of hepatic recurrence and metastasis. MFSD4 expression in gastric tissues may represent a useful biomarker for identification of patients at high risk for hepatic recurrence, metastasis, or both.
format Online
Article
Text
id pubmed-4924669
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Impact Journals LLC
record_format MEDLINE/PubMed
spelling pubmed-49246692016-07-13 Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer Kanda, Mitsuro Shimizu, Dai Tanaka, Haruyoshi Shibata, Masahiro Iwata, Naoki Hayashi, Masamichi Kobayashi, Daisuke Tanaka, Chie Yamada, Suguru Fujii, Tsutomu Nakayama, Goro Sugimoto, Hiroyuki Koike, Masahiko Fujiwara, Michitaka Kodera, Yasuhiro Oncotarget Research Paper Gastric cancer (GC) with hepatic metastasis remains a fatal disease. Global expression profiling was conducted using tissues from patients who had GC with synchronous hepatic metastasis, and major facilitator superfamily domain containing 4 (MFSD4) was identified as a candidate biomarker for hepatic metastasis in GC. Functional and expression analyses of this molecule in GC cell lines and clinical samples were conducted. We analyzed MFSD4 expression, DNA methylation, and copy number. RNA interference experiments evaluated the effects of MFSD4 expression on cell phenotype and apoptosis. We analyzed tissues of 200 patients with GC to assess the diagnostic performance of MFSD4 levels for predicting hepatic recurrence, metastasis, or both. Differential expression of MFSD4 mRNA by GC cell lines correlated positively with the levels of NUDT13 and OCLN mRNAs and inversely with those of BMP2. Hypermethylation of the MFSD4 promoter was detected in cells with lower levels of MFSD4 mRNA. Inhibition of MFSD4 expression significantly increased the invasiveness and motility of GC cells but did not influence cell proliferation or apoptosis. MFSD4 mRNA levels in primary GC tissues were reduced in patients with concomitant hepatic metastasis or recurrence compared with those without. Low levels of MFSD4 mRNA in primary GC tissues were an independent risk factor of hepatic recurrence and metastasis. MFSD4 expression in gastric tissues may represent a useful biomarker for identification of patients at high risk for hepatic recurrence, metastasis, or both. Impact Journals LLC 2016-02-08 /pmc/articles/PMC4924669/ /pubmed/26872374 http://dx.doi.org/10.18632/oncotarget.7269 Text en Copyright: © 2016 Kanda et al. http://creativecommons.org/licenses/by/2.5/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Research Paper
Kanda, Mitsuro
Shimizu, Dai
Tanaka, Haruyoshi
Shibata, Masahiro
Iwata, Naoki
Hayashi, Masamichi
Kobayashi, Daisuke
Tanaka, Chie
Yamada, Suguru
Fujii, Tsutomu
Nakayama, Goro
Sugimoto, Hiroyuki
Koike, Masahiko
Fujiwara, Michitaka
Kodera, Yasuhiro
Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title_full Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title_fullStr Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title_full_unstemmed Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title_short Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
title_sort metastatic pathway-specific transcriptome analysis identifies mfsd4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4924669/
https://www.ncbi.nlm.nih.gov/pubmed/26872374
http://dx.doi.org/10.18632/oncotarget.7269
work_keys_str_mv AT kandamitsuro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT shimizudai metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT tanakaharuyoshi metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT shibatamasahiro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT iwatanaoki metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT hayashimasamichi metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT kobayashidaisuke metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT tanakachie metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT yamadasuguru metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT fujiitsutomu metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT nakayamagoro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT sugimotohiroyuki metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT koikemasahiko metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT fujiwaramichitaka metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer
AT koderayasuhiro metastaticpathwayspecifictranscriptomeanalysisidentifiesmfsd4asaputativetumorsuppressorandbiomarkerforhepaticmetastasisinpatientswithgastriccancer