Cargando…

Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review

Growth factors play an important role during early ovarian development and folliculogenesis, since they regulate the migration of germ cells to the gonadal ridge. They also act on follicle recruitment, proliferation/atresia of granulosa cells and theca, steroidogenesis, oocyte maturation, ovulation...

Descripción completa

Detalles Bibliográficos
Autores principales: de Castro, Fernanda Cavallari, Cruz, Maria Helena Coelho, Leal, Claudia Lima Verde
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Asian-Australasian Association of Animal Production Societies (AAAP) and Korean Society of Animal Science and Technology (KSAST) 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4932559/
https://www.ncbi.nlm.nih.gov/pubmed/26954112
http://dx.doi.org/10.5713/ajas.15.0797
_version_ 1782441079871635456
author de Castro, Fernanda Cavallari
Cruz, Maria Helena Coelho
Leal, Claudia Lima Verde
author_facet de Castro, Fernanda Cavallari
Cruz, Maria Helena Coelho
Leal, Claudia Lima Verde
author_sort de Castro, Fernanda Cavallari
collection PubMed
description Growth factors play an important role during early ovarian development and folliculogenesis, since they regulate the migration of germ cells to the gonadal ridge. They also act on follicle recruitment, proliferation/atresia of granulosa cells and theca, steroidogenesis, oocyte maturation, ovulation and luteinization. Among the growth factors, the growth differentiation factor 9 (GDF9) and the bone morphogenetic protein 15 (BMP15), belong to the transforming growth factor beta (TGF-β) superfamily, have been implicated as essential for follicular development. The GDF9 and BMP15 participate in the evolution of the primordial follicle to primary follicle and play an important role in the later stages of follicular development and maturation, increasing the steroidogenic acute regulatory protein expression, plasminogen activator and luteinizing hormone receptor (LHR). These factors are also involved in the interconnections between the oocyte and surrounding cumulus cells, where they regulate absorption of amino acids, glycolysis and biosynthesis of cholesterol cumulus cells. Even though the mode of action has not been fully established, in vitro observations indicate that the factors GDF9 and BMP15 stimulate the growth of ovarian follicles and proliferation of cumulus cells through the induction of mitosis in cells and granulosa and theca expression of genes linked to follicular maturation. Thus, seeking greater understanding of the action of these growth factors on the development of oocytes, the role of GDF9 and BMP15 in ovarian function is summarized in this brief review.
format Online
Article
Text
id pubmed-4932559
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher Asian-Australasian Association of Animal Production Societies (AAAP) and Korean Society of Animal Science and Technology (KSAST)
record_format MEDLINE/PubMed
spelling pubmed-49325592016-08-01 Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review de Castro, Fernanda Cavallari Cruz, Maria Helena Coelho Leal, Claudia Lima Verde Asian-Australas J Anim Sci Review Paper Growth factors play an important role during early ovarian development and folliculogenesis, since they regulate the migration of germ cells to the gonadal ridge. They also act on follicle recruitment, proliferation/atresia of granulosa cells and theca, steroidogenesis, oocyte maturation, ovulation and luteinization. Among the growth factors, the growth differentiation factor 9 (GDF9) and the bone morphogenetic protein 15 (BMP15), belong to the transforming growth factor beta (TGF-β) superfamily, have been implicated as essential for follicular development. The GDF9 and BMP15 participate in the evolution of the primordial follicle to primary follicle and play an important role in the later stages of follicular development and maturation, increasing the steroidogenic acute regulatory protein expression, plasminogen activator and luteinizing hormone receptor (LHR). These factors are also involved in the interconnections between the oocyte and surrounding cumulus cells, where they regulate absorption of amino acids, glycolysis and biosynthesis of cholesterol cumulus cells. Even though the mode of action has not been fully established, in vitro observations indicate that the factors GDF9 and BMP15 stimulate the growth of ovarian follicles and proliferation of cumulus cells through the induction of mitosis in cells and granulosa and theca expression of genes linked to follicular maturation. Thus, seeking greater understanding of the action of these growth factors on the development of oocytes, the role of GDF9 and BMP15 in ovarian function is summarized in this brief review. Asian-Australasian Association of Animal Production Societies (AAAP) and Korean Society of Animal Science and Technology (KSAST) 2016-08 2015-12-26 /pmc/articles/PMC4932559/ /pubmed/26954112 http://dx.doi.org/10.5713/ajas.15.0797 Text en Copyright © 2016 by Asian-Australasian Journal of Animal Sciences This is an open-access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/), which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Paper
de Castro, Fernanda Cavallari
Cruz, Maria Helena Coelho
Leal, Claudia Lima Verde
Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title_full Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title_fullStr Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title_full_unstemmed Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title_short Role of Growth Differentiation Factor 9 and Bone Morphogenetic Protein 15 in Ovarian Function and Their Importance in Mammalian Female Fertility — A Review
title_sort role of growth differentiation factor 9 and bone morphogenetic protein 15 in ovarian function and their importance in mammalian female fertility — a review
topic Review Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4932559/
https://www.ncbi.nlm.nih.gov/pubmed/26954112
http://dx.doi.org/10.5713/ajas.15.0797
work_keys_str_mv AT decastrofernandacavallari roleofgrowthdifferentiationfactor9andbonemorphogeneticprotein15inovarianfunctionandtheirimportanceinmammalianfemalefertilityareview
AT cruzmariahelenacoelho roleofgrowthdifferentiationfactor9andbonemorphogeneticprotein15inovarianfunctionandtheirimportanceinmammalianfemalefertilityareview
AT lealclaudialimaverde roleofgrowthdifferentiationfactor9andbonemorphogeneticprotein15inovarianfunctionandtheirimportanceinmammalianfemalefertilityareview