Cargando…
The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol
BACKGROUND: There is increasing pressure to address the social determinants of health (SDoH) and health inequities through the implementation of culturally acceptable interventions particularly in Sub-Saharan Africa (SSA) where health outcomes are generally poor. Available evaluation research on cas...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4944314/ https://www.ncbi.nlm.nih.gov/pubmed/27412361 http://dx.doi.org/10.1186/s13643-016-0295-4 |
_version_ | 1782442745135104000 |
---|---|
author | Owusu-Addo, Ebenezer Renzaho, Andre M.N. Mahal, Ajay S. Smith, Ben J. |
author_facet | Owusu-Addo, Ebenezer Renzaho, Andre M.N. Mahal, Ajay S. Smith, Ben J. |
author_sort | Owusu-Addo, Ebenezer |
collection | PubMed |
description | BACKGROUND: There is increasing pressure to address the social determinants of health (SDoH) and health inequities through the implementation of culturally acceptable interventions particularly in Sub-Saharan Africa (SSA) where health outcomes are generally poor. Available evaluation research on cash transfers (CTs) suggests that the programs may influence the wider determinants of health in SSA; yet, there has been no attempt to synthesize the evidence regarding their contribution to tackling the SDoH and health inequalities. To date, nearly all the reviews on CTs' impact on health have predominantly featured evidence from Latin America with limited transferability to the social, cultural, and political environments in SSA. Therefore, the aim of this study is to undertake a systematic review to assess the role of CTs in tackling the wider determinants of health and health inequalities in SSA. METHODS/DESIGN: A systematic review of published and unpublished literature on CTs’ impact on health and health determinants covering the period 2000–2016 will be undertaken. Studies will be considered for inclusion if they present quantitative or qualitative data, including all relevant study designs. The SDoH conceptual framework will be used to guide the data extraction process. EPPI Reviewer software will be used for data management and analysis. Studies included in the review will be analyzed by narrative synthesis and/or meta-analysis as appropriate for the nature of the data retrieved. DISCUSSION: This review will provide empirical evidence on the impact of CTs on SDoH to inform CT policy, implementation, and research in SSA. The protocol follows the Preferred Reporting Items for Systematic Review and Meta-Analysis Protocols (PRISMA-P). SYSTEMATIC REVIEW REGISTRATION: This protocol has been registered with the PROSPERO international prospective register of systematic reviews, reference CRD42015025015. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-016-0295-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-4944314 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49443142016-07-15 The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol Owusu-Addo, Ebenezer Renzaho, Andre M.N. Mahal, Ajay S. Smith, Ben J. Syst Rev Protocol BACKGROUND: There is increasing pressure to address the social determinants of health (SDoH) and health inequities through the implementation of culturally acceptable interventions particularly in Sub-Saharan Africa (SSA) where health outcomes are generally poor. Available evaluation research on cash transfers (CTs) suggests that the programs may influence the wider determinants of health in SSA; yet, there has been no attempt to synthesize the evidence regarding their contribution to tackling the SDoH and health inequalities. To date, nearly all the reviews on CTs' impact on health have predominantly featured evidence from Latin America with limited transferability to the social, cultural, and political environments in SSA. Therefore, the aim of this study is to undertake a systematic review to assess the role of CTs in tackling the wider determinants of health and health inequalities in SSA. METHODS/DESIGN: A systematic review of published and unpublished literature on CTs’ impact on health and health determinants covering the period 2000–2016 will be undertaken. Studies will be considered for inclusion if they present quantitative or qualitative data, including all relevant study designs. The SDoH conceptual framework will be used to guide the data extraction process. EPPI Reviewer software will be used for data management and analysis. Studies included in the review will be analyzed by narrative synthesis and/or meta-analysis as appropriate for the nature of the data retrieved. DISCUSSION: This review will provide empirical evidence on the impact of CTs on SDoH to inform CT policy, implementation, and research in SSA. The protocol follows the Preferred Reporting Items for Systematic Review and Meta-Analysis Protocols (PRISMA-P). SYSTEMATIC REVIEW REGISTRATION: This protocol has been registered with the PROSPERO international prospective register of systematic reviews, reference CRD42015025015. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s13643-016-0295-4) contains supplementary material, which is available to authorized users. BioMed Central 2016-07-13 /pmc/articles/PMC4944314/ /pubmed/27412361 http://dx.doi.org/10.1186/s13643-016-0295-4 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Protocol Owusu-Addo, Ebenezer Renzaho, Andre M.N. Mahal, Ajay S. Smith, Ben J. The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title | The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title_full | The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title_fullStr | The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title_full_unstemmed | The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title_short | The impact of cash transfers on social determinants of health and health inequalities in Sub-Saharan Africa: a systematic review protocol |
title_sort | impact of cash transfers on social determinants of health and health inequalities in sub-saharan africa: a systematic review protocol |
topic | Protocol |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4944314/ https://www.ncbi.nlm.nih.gov/pubmed/27412361 http://dx.doi.org/10.1186/s13643-016-0295-4 |
work_keys_str_mv | AT owusuaddoebenezer theimpactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT renzahoandremn theimpactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT mahalajays theimpactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT smithbenj theimpactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT owusuaddoebenezer impactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT renzahoandremn impactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT mahalajays impactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol AT smithbenj impactofcashtransfersonsocialdeterminantsofhealthandhealthinequalitiesinsubsaharanafricaasystematicreviewprotocol |