Cargando…

The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis

BACKGROUND: Understanding malaria along the international border of two countries is important for malaria control and elimination; however, it is difficult to investigate a quantitative relationship between two countries’ border areas due to a shortage of malaria surveillance data. METHODS: A linea...

Descripción completa

Detalles Bibliográficos
Autores principales: Xu, Jian-Wei, Liu, Hui
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4949750/
https://www.ncbi.nlm.nih.gov/pubmed/27430217
http://dx.doi.org/10.1186/s12936-016-1413-4
_version_ 1782443487185076224
author Xu, Jian-Wei
Liu, Hui
author_facet Xu, Jian-Wei
Liu, Hui
author_sort Xu, Jian-Wei
collection PubMed
description BACKGROUND: Understanding malaria along the international border of two countries is important for malaria control and elimination; however, it is difficult to investigate a quantitative relationship between two countries’ border areas due to a shortage of malaria surveillance data. METHODS: A linear regression analysis was conducted to investigate the logarithmic annual parasite incidence (API), numbers of imported cases and local infections in 19 Chinese border counties, with logarithmic API and parasitic prevalence in Myanmar’s five special regions. RESULTS: API in 19 Chinese counties was stronger correlated with parasite prevalence than with API in five special regions of Myanmar, correlation coefficient (R) 0.8322 (95 % CI 0.0636–0.9084) versus 0.9914 (95 % CI 0.9204–0.9914). Numbers of imported malaria cases and local malaria infections in 19 Chinese counties were also closer correlated with parasite prevalence than with API in five special regions of Myanmar. CONCLUSIONS: There is a strong correlation of malaria between China’s side and Myanmar’s side along the international border. Parasite prevalence is a better indicator of the true malaria situation in a setting without sound surveillance and reporting system. China should reconsider its definition of imported malaria which neglects imported malaria by mosquitoes and asymptomatic parasite carriers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12936-016-1413-4) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4949750
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-49497502016-07-20 The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis Xu, Jian-Wei Liu, Hui Malar J Research BACKGROUND: Understanding malaria along the international border of two countries is important for malaria control and elimination; however, it is difficult to investigate a quantitative relationship between two countries’ border areas due to a shortage of malaria surveillance data. METHODS: A linear regression analysis was conducted to investigate the logarithmic annual parasite incidence (API), numbers of imported cases and local infections in 19 Chinese border counties, with logarithmic API and parasitic prevalence in Myanmar’s five special regions. RESULTS: API in 19 Chinese counties was stronger correlated with parasite prevalence than with API in five special regions of Myanmar, correlation coefficient (R) 0.8322 (95 % CI 0.0636–0.9084) versus 0.9914 (95 % CI 0.9204–0.9914). Numbers of imported malaria cases and local malaria infections in 19 Chinese counties were also closer correlated with parasite prevalence than with API in five special regions of Myanmar. CONCLUSIONS: There is a strong correlation of malaria between China’s side and Myanmar’s side along the international border. Parasite prevalence is a better indicator of the true malaria situation in a setting without sound surveillance and reporting system. China should reconsider its definition of imported malaria which neglects imported malaria by mosquitoes and asymptomatic parasite carriers. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12936-016-1413-4) contains supplementary material, which is available to authorized users. BioMed Central 2016-07-18 /pmc/articles/PMC4949750/ /pubmed/27430217 http://dx.doi.org/10.1186/s12936-016-1413-4 Text en © The Author(s) 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Xu, Jian-Wei
Liu, Hui
The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title_full The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title_fullStr The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title_full_unstemmed The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title_short The relationship of malaria between Chinese side and Myanmar’s five special regions along China–Myanmar border: a linear regression analysis
title_sort relationship of malaria between chinese side and myanmar’s five special regions along china–myanmar border: a linear regression analysis
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4949750/
https://www.ncbi.nlm.nih.gov/pubmed/27430217
http://dx.doi.org/10.1186/s12936-016-1413-4
work_keys_str_mv AT xujianwei therelationshipofmalariabetweenchinesesideandmyanmarsfivespecialregionsalongchinamyanmarborderalinearregressionanalysis
AT liuhui therelationshipofmalariabetweenchinesesideandmyanmarsfivespecialregionsalongchinamyanmarborderalinearregressionanalysis
AT xujianwei relationshipofmalariabetweenchinesesideandmyanmarsfivespecialregionsalongchinamyanmarborderalinearregressionanalysis
AT liuhui relationshipofmalariabetweenchinesesideandmyanmarsfivespecialregionsalongchinamyanmarborderalinearregressionanalysis