Cargando…
Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are alte...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4952063/ https://www.ncbi.nlm.nih.gov/pubmed/27435453 http://dx.doi.org/10.1186/s12886-016-0289-y |
_version_ | 1782443775847563264 |
---|---|
author | Lv, Yingjuan Yao, Qingbin Ma, Wenjiang Liu, Hua Ji, Jian Li, Xiaorong |
author_facet | Lv, Yingjuan Yao, Qingbin Ma, Wenjiang Liu, Hua Ji, Jian Li, Xiaorong |
author_sort | Lv, Yingjuan |
collection | PubMed |
description | BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are altered in primary open-angle glaucoma subjects carrying the risk allele, and whether vitamin D deficiency is an important factor in the development of glaucoma. METHODS: Seventy-three POAG patients and 71 age-matched controls from the Han population were enrolled. Serum levels of 1a, 25-Dihydroxyvitamin D3 were measured by enzyme-linked immunoabsorbent assay. Vitamin D receptor polymorphisms (Cdx-2, Fok I, Bsm I and Taq I) were analyzed using real-time polymerase-chain reaction high resolution melting analysis. RESULTS: Serum levels of 1a, 25-Dihydroxyvitamin in primary open-angle glaucoma patients were lower than in age-matched controls. Statistical analysis revealed a significant difference in the allelic frequencies of the BsmI and TaqI genotypes between primary open-angle glaucoma patients and age-matched controls, while other polymorphisms did not show any significant differences. CONCLUSIONS: Vitamin D deficiency and the presence of the BsmI ‘B’ allele and the TaqI ‘t’ allele are relevant risk factors in the development of glaucoma. TRIAL REGISTRATION: Clinical Trials.gov: NCT02539745. The study was registered retrospectively on August 3rd, 2015. The first participant was enrolled on July 4th, 2013. |
format | Online Article Text |
id | pubmed-4952063 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49520632016-07-21 Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma Lv, Yingjuan Yao, Qingbin Ma, Wenjiang Liu, Hua Ji, Jian Li, Xiaorong BMC Ophthalmol Research Article BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are altered in primary open-angle glaucoma subjects carrying the risk allele, and whether vitamin D deficiency is an important factor in the development of glaucoma. METHODS: Seventy-three POAG patients and 71 age-matched controls from the Han population were enrolled. Serum levels of 1a, 25-Dihydroxyvitamin D3 were measured by enzyme-linked immunoabsorbent assay. Vitamin D receptor polymorphisms (Cdx-2, Fok I, Bsm I and Taq I) were analyzed using real-time polymerase-chain reaction high resolution melting analysis. RESULTS: Serum levels of 1a, 25-Dihydroxyvitamin in primary open-angle glaucoma patients were lower than in age-matched controls. Statistical analysis revealed a significant difference in the allelic frequencies of the BsmI and TaqI genotypes between primary open-angle glaucoma patients and age-matched controls, while other polymorphisms did not show any significant differences. CONCLUSIONS: Vitamin D deficiency and the presence of the BsmI ‘B’ allele and the TaqI ‘t’ allele are relevant risk factors in the development of glaucoma. TRIAL REGISTRATION: Clinical Trials.gov: NCT02539745. The study was registered retrospectively on August 3rd, 2015. The first participant was enrolled on July 4th, 2013. BioMed Central 2016-07-19 /pmc/articles/PMC4952063/ /pubmed/27435453 http://dx.doi.org/10.1186/s12886-016-0289-y Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Lv, Yingjuan Yao, Qingbin Ma, Wenjiang Liu, Hua Ji, Jian Li, Xiaorong Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title | Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title_full | Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title_fullStr | Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title_full_unstemmed | Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title_short | Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma |
title_sort | associations of vitamin d deficiency and vitamin d receptor (cdx-2, fok i, bsm i and taq i) polymorphisms with the risk of primary open-angle glaucoma |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4952063/ https://www.ncbi.nlm.nih.gov/pubmed/27435453 http://dx.doi.org/10.1186/s12886-016-0289-y |
work_keys_str_mv | AT lvyingjuan associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma AT yaoqingbin associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma AT mawenjiang associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma AT liuhua associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma AT jijian associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma AT lixiaorong associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma |