Cargando…

Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma

BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are alte...

Descripción completa

Detalles Bibliográficos
Autores principales: Lv, Yingjuan, Yao, Qingbin, Ma, Wenjiang, Liu, Hua, Ji, Jian, Li, Xiaorong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4952063/
https://www.ncbi.nlm.nih.gov/pubmed/27435453
http://dx.doi.org/10.1186/s12886-016-0289-y
_version_ 1782443775847563264
author Lv, Yingjuan
Yao, Qingbin
Ma, Wenjiang
Liu, Hua
Ji, Jian
Li, Xiaorong
author_facet Lv, Yingjuan
Yao, Qingbin
Ma, Wenjiang
Liu, Hua
Ji, Jian
Li, Xiaorong
author_sort Lv, Yingjuan
collection PubMed
description BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are altered in primary open-angle glaucoma subjects carrying the risk allele, and whether vitamin D deficiency is an important factor in the development of glaucoma. METHODS: Seventy-three POAG patients and 71 age-matched controls from the Han population were enrolled. Serum levels of 1a, 25-Dihydroxyvitamin D3 were measured by enzyme-linked immunoabsorbent assay. Vitamin D receptor polymorphisms (Cdx-2, Fok I, Bsm I and Taq I) were analyzed using real-time polymerase-chain reaction high resolution melting analysis. RESULTS: Serum levels of 1a, 25-Dihydroxyvitamin in primary open-angle glaucoma patients were lower than in age-matched controls. Statistical analysis revealed a significant difference in the allelic frequencies of the BsmI and TaqI genotypes between primary open-angle glaucoma patients and age-matched controls, while other polymorphisms did not show any significant differences. CONCLUSIONS: Vitamin D deficiency and the presence of the BsmI ‘B’ allele and the TaqI ‘t’ allele are relevant risk factors in the development of glaucoma. TRIAL REGISTRATION: Clinical Trials.gov: NCT02539745. The study was registered retrospectively on August 3rd, 2015. The first participant was enrolled on July 4th, 2013.
format Online
Article
Text
id pubmed-4952063
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-49520632016-07-21 Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma Lv, Yingjuan Yao, Qingbin Ma, Wenjiang Liu, Hua Ji, Jian Li, Xiaorong BMC Ophthalmol Research Article BACKGROUND: Vitamin D deficiency and vitamin D receptor gene polymorphisms are known to be significantly associated with high myopia. Whether this genetic variant may impact primary open-angle glaucoma is largely unknown. This study investigated whether vitamin D receptor gene polymorphisms are altered in primary open-angle glaucoma subjects carrying the risk allele, and whether vitamin D deficiency is an important factor in the development of glaucoma. METHODS: Seventy-three POAG patients and 71 age-matched controls from the Han population were enrolled. Serum levels of 1a, 25-Dihydroxyvitamin D3 were measured by enzyme-linked immunoabsorbent assay. Vitamin D receptor polymorphisms (Cdx-2, Fok I, Bsm I and Taq I) were analyzed using real-time polymerase-chain reaction high resolution melting analysis. RESULTS: Serum levels of 1a, 25-Dihydroxyvitamin in primary open-angle glaucoma patients were lower than in age-matched controls. Statistical analysis revealed a significant difference in the allelic frequencies of the BsmI and TaqI genotypes between primary open-angle glaucoma patients and age-matched controls, while other polymorphisms did not show any significant differences. CONCLUSIONS: Vitamin D deficiency and the presence of the BsmI ‘B’ allele and the TaqI ‘t’ allele are relevant risk factors in the development of glaucoma. TRIAL REGISTRATION: Clinical Trials.gov: NCT02539745. The study was registered retrospectively on August 3rd, 2015. The first participant was enrolled on July 4th, 2013. BioMed Central 2016-07-19 /pmc/articles/PMC4952063/ /pubmed/27435453 http://dx.doi.org/10.1186/s12886-016-0289-y Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Lv, Yingjuan
Yao, Qingbin
Ma, Wenjiang
Liu, Hua
Ji, Jian
Li, Xiaorong
Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title_full Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title_fullStr Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title_full_unstemmed Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title_short Associations of vitamin D deficiency and vitamin D receptor (Cdx-2, Fok I, Bsm I and Taq I) polymorphisms with the risk of primary open-angle glaucoma
title_sort associations of vitamin d deficiency and vitamin d receptor (cdx-2, fok i, bsm i and taq i) polymorphisms with the risk of primary open-angle glaucoma
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4952063/
https://www.ncbi.nlm.nih.gov/pubmed/27435453
http://dx.doi.org/10.1186/s12886-016-0289-y
work_keys_str_mv AT lvyingjuan associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma
AT yaoqingbin associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma
AT mawenjiang associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma
AT liuhua associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma
AT jijian associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma
AT lixiaorong associationsofvitaminddeficiencyandvitamindreceptorcdx2fokibsmiandtaqipolymorphismswiththeriskofprimaryopenangleglaucoma