Cargando…
Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study
BACKGROUND: Low participation rates among ethnic minorities in preventive healthcare services are worrisome and not well understood. The objective of this study was to explore how adults of Turkish and Moroccan origin living in the Netherlands, aged 45 years and older, can be reached to participate...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4955164/ https://www.ncbi.nlm.nih.gov/pubmed/27439610 http://dx.doi.org/10.1186/s12875-016-0476-1 |
_version_ | 1782443898932559872 |
---|---|
author | Bukman, Andrea J. Teuscher, Dorit Ben Meftah, Jamila Groenenberg, Iris Crone, Mathilde R. van Dijk, Sandra Bos, Marieke B. Feskens, Edith J. M. |
author_facet | Bukman, Andrea J. Teuscher, Dorit Ben Meftah, Jamila Groenenberg, Iris Crone, Mathilde R. van Dijk, Sandra Bos, Marieke B. Feskens, Edith J. M. |
author_sort | Bukman, Andrea J. |
collection | PubMed |
description | BACKGROUND: Low participation rates among ethnic minorities in preventive healthcare services are worrisome and not well understood. The objective of this study was to explore how adults of Turkish and Moroccan origin living in the Netherlands, aged 45 years and older, can be reached to participate in health checks for cardio-metabolic diseases and follow-up (lifestyle) advice. METHODS: This mixed-methods study used a convergent parallel design, to combine data of one quantitative study and three qualitative studies. Questionnaire data were included of 310 respondents, and interview data from 22 focus groups and four individual interviews. Participants were recruited via a research database, general practitioners and key figures. Quantitative data were analysed descriptively and qualitative data were analysed using a thematic approach. RESULTS: Regarding health checks, 50 % (95 % CI 41;59) of the Turkish questionnaire respondents and 66 % (95 % CI 57;76) of the Moroccan questionnaire respondents preferred an invitation from their general practitioner. The preferred location to fill out the health check questionnaire was for both ethnic groups the general practitioner’s office or at home, on paper. Regarding advice, both groups preferred to receive advice at individual level rather than in a group, via either a physician or a specialised healthcare professional. It was emphasised that the person who gives lifestyle advice should be familiar with the (eating) habits of the targeted individual. Sixty-one percent (95 % CI 53;69) of the Turkish respondents preferred to receive information in their native language compared to 37 % (95 % CI 29;45) of the Moroccan respondents. Several participants mentioned a low proficiency in the local language as an explanation for their preference to fill out the health check questionnaire at home, to receive advice from an ethnic-matched professional, and to receive information in their native language. CONCLUSIONS: The general practitioner is considered as a promising contact to reach adults of Turkish and Moroccan origin for health checks or (lifestyle) advice. It might be necessary to provide information in individuals’ native language to overcome language barriers. In addition, (lifestyle) advice must be tailored. The obtained insight into preferences of Turkish and Moroccan adults regarding reach for preventive healthcare services could help professionals to successfully target these groups. |
format | Online Article Text |
id | pubmed-4955164 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49551642016-07-22 Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study Bukman, Andrea J. Teuscher, Dorit Ben Meftah, Jamila Groenenberg, Iris Crone, Mathilde R. van Dijk, Sandra Bos, Marieke B. Feskens, Edith J. M. BMC Fam Pract Research Article BACKGROUND: Low participation rates among ethnic minorities in preventive healthcare services are worrisome and not well understood. The objective of this study was to explore how adults of Turkish and Moroccan origin living in the Netherlands, aged 45 years and older, can be reached to participate in health checks for cardio-metabolic diseases and follow-up (lifestyle) advice. METHODS: This mixed-methods study used a convergent parallel design, to combine data of one quantitative study and three qualitative studies. Questionnaire data were included of 310 respondents, and interview data from 22 focus groups and four individual interviews. Participants were recruited via a research database, general practitioners and key figures. Quantitative data were analysed descriptively and qualitative data were analysed using a thematic approach. RESULTS: Regarding health checks, 50 % (95 % CI 41;59) of the Turkish questionnaire respondents and 66 % (95 % CI 57;76) of the Moroccan questionnaire respondents preferred an invitation from their general practitioner. The preferred location to fill out the health check questionnaire was for both ethnic groups the general practitioner’s office or at home, on paper. Regarding advice, both groups preferred to receive advice at individual level rather than in a group, via either a physician or a specialised healthcare professional. It was emphasised that the person who gives lifestyle advice should be familiar with the (eating) habits of the targeted individual. Sixty-one percent (95 % CI 53;69) of the Turkish respondents preferred to receive information in their native language compared to 37 % (95 % CI 29;45) of the Moroccan respondents. Several participants mentioned a low proficiency in the local language as an explanation for their preference to fill out the health check questionnaire at home, to receive advice from an ethnic-matched professional, and to receive information in their native language. CONCLUSIONS: The general practitioner is considered as a promising contact to reach adults of Turkish and Moroccan origin for health checks or (lifestyle) advice. It might be necessary to provide information in individuals’ native language to overcome language barriers. In addition, (lifestyle) advice must be tailored. The obtained insight into preferences of Turkish and Moroccan adults regarding reach for preventive healthcare services could help professionals to successfully target these groups. BioMed Central 2016-07-21 /pmc/articles/PMC4955164/ /pubmed/27439610 http://dx.doi.org/10.1186/s12875-016-0476-1 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Bukman, Andrea J. Teuscher, Dorit Ben Meftah, Jamila Groenenberg, Iris Crone, Mathilde R. van Dijk, Sandra Bos, Marieke B. Feskens, Edith J. M. Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title | Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title_full | Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title_fullStr | Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title_full_unstemmed | Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title_short | Exploring strategies to reach individuals of Turkish and Moroccan origin for health checks and lifestyle advice: a mixed-methods study |
title_sort | exploring strategies to reach individuals of turkish and moroccan origin for health checks and lifestyle advice: a mixed-methods study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4955164/ https://www.ncbi.nlm.nih.gov/pubmed/27439610 http://dx.doi.org/10.1186/s12875-016-0476-1 |
work_keys_str_mv | AT bukmanandreaj exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT teuscherdorit exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT benmeftahjamila exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT groenenbergiris exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT cronemathilder exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT vandijksandra exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT bosmariekeb exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy AT feskensedithjm exploringstrategiestoreachindividualsofturkishandmoroccanoriginforhealthchecksandlifestyleadviceamixedmethodsstudy |