Cargando…
Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances
BACKGROUND: There is currently limited evidence regarding the extent Real World Evidence (RWE) has directly impacted the health and social care systems. The aim of this review is to identify national guidelines or guidances published in England from 2000 onwards which have referenced studies using t...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2016
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4960862/ https://www.ncbi.nlm.nih.gov/pubmed/27456701 http://dx.doi.org/10.1186/s12913-016-1562-8 |
_version_ | 1782444601993330688 |
---|---|
author | Oyinlola, Jessie O. Campbell, Jennifer Kousoulis, Antonis A. |
author_facet | Oyinlola, Jessie O. Campbell, Jennifer Kousoulis, Antonis A. |
author_sort | Oyinlola, Jessie O. |
collection | PubMed |
description | BACKGROUND: There is currently limited evidence regarding the extent Real World Evidence (RWE) has directly impacted the health and social care systems. The aim of this review is to identify national guidelines or guidances published in England from 2000 onwards which have referenced studies using the governmental primary care data provider the Clinical Practice Research Datalink (CPRD). METHODS: The methodology recommended by Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) was followed. Four databases were searched and documents of interest were identified through a search algorithm containing keywords relevant to CPRD. A search diary was maintained with the inclusion/exclusion decisions which were performed by two independent reviewers. RESULTS: Twenty-five guidance documents were included in the final review (following screening and assessment for eligibility), referencing 43 different CPRD/GPRD studies, all published since 2007. The documents covered 12 disease areas, with the majority (N =7) relevant to diseases of the Central Nervous system (CNS). The 43 studies provided evidence of disease epidemiology, incidence/prevalence, pharmacoepidemiology, pharmacovigilance and health utilisation. CONCLUSIONS: A slow uptake of RWE in clinical and therapeutic guidelines (as provided by UK governmental structures) was noticed. However, there seems to be an increasing trend in the use of healthcare system data to inform clinical practice, especially as the real world validity of clinical trials is being questioned. In order to accommodate this increasing demand and meet the paradigm shift expected, organisations need to work together to enable or improve data access, undertake translational and relevant research and establish sources of reliable evidence. |
format | Online Article Text |
id | pubmed-4960862 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2016 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-49608622016-07-27 Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances Oyinlola, Jessie O. Campbell, Jennifer Kousoulis, Antonis A. BMC Health Serv Res Research Article BACKGROUND: There is currently limited evidence regarding the extent Real World Evidence (RWE) has directly impacted the health and social care systems. The aim of this review is to identify national guidelines or guidances published in England from 2000 onwards which have referenced studies using the governmental primary care data provider the Clinical Practice Research Datalink (CPRD). METHODS: The methodology recommended by Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) was followed. Four databases were searched and documents of interest were identified through a search algorithm containing keywords relevant to CPRD. A search diary was maintained with the inclusion/exclusion decisions which were performed by two independent reviewers. RESULTS: Twenty-five guidance documents were included in the final review (following screening and assessment for eligibility), referencing 43 different CPRD/GPRD studies, all published since 2007. The documents covered 12 disease areas, with the majority (N =7) relevant to diseases of the Central Nervous system (CNS). The 43 studies provided evidence of disease epidemiology, incidence/prevalence, pharmacoepidemiology, pharmacovigilance and health utilisation. CONCLUSIONS: A slow uptake of RWE in clinical and therapeutic guidelines (as provided by UK governmental structures) was noticed. However, there seems to be an increasing trend in the use of healthcare system data to inform clinical practice, especially as the real world validity of clinical trials is being questioned. In order to accommodate this increasing demand and meet the paradigm shift expected, organisations need to work together to enable or improve data access, undertake translational and relevant research and establish sources of reliable evidence. BioMed Central 2016-07-26 /pmc/articles/PMC4960862/ /pubmed/27456701 http://dx.doi.org/10.1186/s12913-016-1562-8 Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Oyinlola, Jessie O. Campbell, Jennifer Kousoulis, Antonis A. Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title | Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title_full | Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title_fullStr | Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title_full_unstemmed | Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title_short | Is real world evidence influencing practice? A systematic review of CPRD research in NICE guidances |
title_sort | is real world evidence influencing practice? a systematic review of cprd research in nice guidances |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4960862/ https://www.ncbi.nlm.nih.gov/pubmed/27456701 http://dx.doi.org/10.1186/s12913-016-1562-8 |
work_keys_str_mv | AT oyinlolajessieo isrealworldevidenceinfluencingpracticeasystematicreviewofcprdresearchinniceguidances AT campbelljennifer isrealworldevidenceinfluencingpracticeasystematicreviewofcprdresearchinniceguidances AT kousoulisantonisa isrealworldevidenceinfluencingpracticeasystematicreviewofcprdresearchinniceguidances |