Cargando…
Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
| Autores principales: | , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
American Society for Microbiology
2016
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963540/ https://www.ncbi.nlm.nih.gov/pubmed/27471751 http://dx.doi.org/10.1128/mSphere.00200-16 |
| _version_ | 1782444963266560000 |
|---|---|
| author | Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. |
| author_facet | Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. |
| author_sort | Sarwar, Zaara |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4963540 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2016 |
| publisher | American Society for Microbiology |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-49635402016-07-28 Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. mSphere Erratum American Society for Microbiology 2016-07-27 /pmc/articles/PMC4963540/ /pubmed/27471751 http://dx.doi.org/10.1128/mSphere.00200-16 Text en Copyright © 2016 Sarwar et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (http://creativecommons.org/licenses/by/4.0/) . |
| spellingShingle | Erratum Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title | Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title_full | Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title_fullStr | Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title_full_unstemmed | Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title_short | Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 |
| title_sort | erratum for sarwar et al., gcsr, a tyrr-like enhancer-binding protein, regulates expression of the glycine cleavage system in pseudomonas aeruginosa pao1 |
| topic | Erratum |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963540/ https://www.ncbi.nlm.nih.gov/pubmed/27471751 http://dx.doi.org/10.1128/mSphere.00200-16 |
| work_keys_str_mv | AT sarwarzaara erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT lundgrenbenjaminr erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT grassamichaelt erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT wangmichaelx erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT gribblemegan erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT moffatjenniferf erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 AT nomurachristophert erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1 |