Cargando…

Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1

Detalles Bibliográficos
Autores principales: Sarwar, Zaara, Lundgren, Benjamin R., Grassa, Michael T., Wang, Michael X., Gribble, Megan, Moffat, Jennifer F., Nomura, Christopher T.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963540/
https://www.ncbi.nlm.nih.gov/pubmed/27471751
http://dx.doi.org/10.1128/mSphere.00200-16
_version_ 1782444963266560000
author Sarwar, Zaara
Lundgren, Benjamin R.
Grassa, Michael T.
Wang, Michael X.
Gribble, Megan
Moffat, Jennifer F.
Nomura, Christopher T.
author_facet Sarwar, Zaara
Lundgren, Benjamin R.
Grassa, Michael T.
Wang, Michael X.
Gribble, Megan
Moffat, Jennifer F.
Nomura, Christopher T.
author_sort Sarwar, Zaara
collection PubMed
description
format Online
Article
Text
id pubmed-4963540
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-49635402016-07-28 Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1 Sarwar, Zaara Lundgren, Benjamin R. Grassa, Michael T. Wang, Michael X. Gribble, Megan Moffat, Jennifer F. Nomura, Christopher T. mSphere Erratum American Society for Microbiology 2016-07-27 /pmc/articles/PMC4963540/ /pubmed/27471751 http://dx.doi.org/10.1128/mSphere.00200-16 Text en Copyright © 2016 Sarwar et al. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 4.0 International license (http://creativecommons.org/licenses/by/4.0/) .
spellingShingle Erratum
Sarwar, Zaara
Lundgren, Benjamin R.
Grassa, Michael T.
Wang, Michael X.
Gribble, Megan
Moffat, Jennifer F.
Nomura, Christopher T.
Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title_full Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title_fullStr Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title_full_unstemmed Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title_short Erratum for Sarwar et al., GcsR, a TyrR-Like Enhancer-Binding Protein, Regulates Expression of the Glycine Cleavage System in Pseudomonas aeruginosa PAO1
title_sort erratum for sarwar et al., gcsr, a tyrr-like enhancer-binding protein, regulates expression of the glycine cleavage system in pseudomonas aeruginosa pao1
topic Erratum
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963540/
https://www.ncbi.nlm.nih.gov/pubmed/27471751
http://dx.doi.org/10.1128/mSphere.00200-16
work_keys_str_mv AT sarwarzaara erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT lundgrenbenjaminr erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT grassamichaelt erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT wangmichaelx erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT gribblemegan erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT moffatjenniferf erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1
AT nomurachristophert erratumforsarwaretalgcsratyrrlikeenhancerbindingproteinregulatesexpressionoftheglycinecleavagesysteminpseudomonasaeruginosapao1