Cargando…

Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study

BACKGROUND: A previous genome-wide association study deduced that one (ARS-BFGL-NGS-39328), two (Hapmap26001-BTC-038813 and Hapmap31284-BTC-039204), two (Hapmap26001-BTC-038813 and BTB-00246150), and one (Hapmap50366-BTA-46960) genome-wide significant single nucleotide polymorphisms (SNPs) associate...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Cong, Sun, Dongxiao, Zhang, Shengli, Yang, Shaohua, Alim, M. A., Zhang, Qin, Li, Yanhua, Liu, Lin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2016
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963957/
https://www.ncbi.nlm.nih.gov/pubmed/27468856
http://dx.doi.org/10.1186/s12863-016-0418-x
_version_ 1782445016329748480
author Li, Cong
Sun, Dongxiao
Zhang, Shengli
Yang, Shaohua
Alim, M. A.
Zhang, Qin
Li, Yanhua
Liu, Lin
author_facet Li, Cong
Sun, Dongxiao
Zhang, Shengli
Yang, Shaohua
Alim, M. A.
Zhang, Qin
Li, Yanhua
Liu, Lin
author_sort Li, Cong
collection PubMed
description BACKGROUND: A previous genome-wide association study deduced that one (ARS-BFGL-NGS-39328), two (Hapmap26001-BTC-038813 and Hapmap31284-BTC-039204), two (Hapmap26001-BTC-038813 and BTB-00246150), and one (Hapmap50366-BTA-46960) genome-wide significant single nucleotide polymorphisms (SNPs) associated with milk fatty acids were close to or within the fatty acid synthase (FASN), peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), ATP-binding cassette, sub-family G, member 2 (ABCG2) and insulin-like growth factor 1 (IGF1) genes. To further confirm the linkage and reveal the genetic effects of these four candidate genes on milk fatty acid composition, genetic polymorphisms were identified and genotype-phenotype associations were performed in a Chinese Holstein cattle population. RESULTS: Nine SNPs were identified in FASN, among which SNP rs41919985 was predicted to result in an amino acid substitution from threonine (ACC) to alanine (GCC), five SNPs (rs136947640, rs134340637, rs41919992, rs41919984 and rs41919986) were synonymous mutations, and the remaining three (rs41919999, rs132865003 and rs133498277) were found in FASN introns. Only one SNP each was identified for PPARGC1A, ABCG2 and IGF1. Association studies revealed that FASN, PPARGC1A, ABCG2 and IGF1 were mainly associated with medium-chain saturated fatty acids and long-chain unsaturated fatty acids, especially FASN for C10:0, C12:0 and C14:0. Strong linkage disequilibrium was observed among ARS-BFGL-NGS-39328 and rs132865003 and rs134340637 in FASN (D´ > 0.9), and among Hapmap26001-BTC-038813 and Hapmap31284-BTC-039204 and rs109579682 in PPARGC1A (D´ > 0.9). Subsequently, haplotype-based analysis revealed significant associations of the haplotypes encompassing eight FASN SNPs (rs41919999, rs132865003, rs134340637, rs41919992, rs133498277, rs41919984, rs41919985 and rs41919986) with C10:0, C12:0, C14:0, C18:1n9c, saturated fatty acids (SFA) and unsaturated fatty acids (UFA) (P = 0.0204 to P < 0.0001). CONCLUSION: Our study confirmed the linkage between the significant SNPs in our previous genome-wide association study and variants in FASN and PPARGC1A. SNPs within FASN, PPARGC1A, ABCG2 and IGF1 showed significant genetic effects on milk fatty acid composition in dairy cattle, indicating their potential functions in milk fatty acids synthesis and metabolism. The findings presented here provide evidence for the selection of dairy cows with healthier milk fatty acid composition by marker-assisted breeding or genomic selection schemes, as well as furthering our understanding of technological processing aspects of cows’ milk. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12863-016-0418-x) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-4963957
institution National Center for Biotechnology Information
language English
publishDate 2016
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-49639572016-07-29 Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study Li, Cong Sun, Dongxiao Zhang, Shengli Yang, Shaohua Alim, M. A. Zhang, Qin Li, Yanhua Liu, Lin BMC Genet Research Article BACKGROUND: A previous genome-wide association study deduced that one (ARS-BFGL-NGS-39328), two (Hapmap26001-BTC-038813 and Hapmap31284-BTC-039204), two (Hapmap26001-BTC-038813 and BTB-00246150), and one (Hapmap50366-BTA-46960) genome-wide significant single nucleotide polymorphisms (SNPs) associated with milk fatty acids were close to or within the fatty acid synthase (FASN), peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC1A), ATP-binding cassette, sub-family G, member 2 (ABCG2) and insulin-like growth factor 1 (IGF1) genes. To further confirm the linkage and reveal the genetic effects of these four candidate genes on milk fatty acid composition, genetic polymorphisms were identified and genotype-phenotype associations were performed in a Chinese Holstein cattle population. RESULTS: Nine SNPs were identified in FASN, among which SNP rs41919985 was predicted to result in an amino acid substitution from threonine (ACC) to alanine (GCC), five SNPs (rs136947640, rs134340637, rs41919992, rs41919984 and rs41919986) were synonymous mutations, and the remaining three (rs41919999, rs132865003 and rs133498277) were found in FASN introns. Only one SNP each was identified for PPARGC1A, ABCG2 and IGF1. Association studies revealed that FASN, PPARGC1A, ABCG2 and IGF1 were mainly associated with medium-chain saturated fatty acids and long-chain unsaturated fatty acids, especially FASN for C10:0, C12:0 and C14:0. Strong linkage disequilibrium was observed among ARS-BFGL-NGS-39328 and rs132865003 and rs134340637 in FASN (D´ > 0.9), and among Hapmap26001-BTC-038813 and Hapmap31284-BTC-039204 and rs109579682 in PPARGC1A (D´ > 0.9). Subsequently, haplotype-based analysis revealed significant associations of the haplotypes encompassing eight FASN SNPs (rs41919999, rs132865003, rs134340637, rs41919992, rs133498277, rs41919984, rs41919985 and rs41919986) with C10:0, C12:0, C14:0, C18:1n9c, saturated fatty acids (SFA) and unsaturated fatty acids (UFA) (P = 0.0204 to P < 0.0001). CONCLUSION: Our study confirmed the linkage between the significant SNPs in our previous genome-wide association study and variants in FASN and PPARGC1A. SNPs within FASN, PPARGC1A, ABCG2 and IGF1 showed significant genetic effects on milk fatty acid composition in dairy cattle, indicating their potential functions in milk fatty acids synthesis and metabolism. The findings presented here provide evidence for the selection of dairy cows with healthier milk fatty acid composition by marker-assisted breeding or genomic selection schemes, as well as furthering our understanding of technological processing aspects of cows’ milk. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1186/s12863-016-0418-x) contains supplementary material, which is available to authorized users. BioMed Central 2016-07-28 /pmc/articles/PMC4963957/ /pubmed/27468856 http://dx.doi.org/10.1186/s12863-016-0418-x Text en © The Author(s). 2016 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Li, Cong
Sun, Dongxiao
Zhang, Shengli
Yang, Shaohua
Alim, M. A.
Zhang, Qin
Li, Yanhua
Liu, Lin
Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title_full Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title_fullStr Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title_full_unstemmed Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title_short Genetic effects of FASN, PPARGC1A, ABCG2 and IGF1 revealing the association with milk fatty acids in a Chinese Holstein cattle population based on a post genome-wide association study
title_sort genetic effects of fasn, ppargc1a, abcg2 and igf1 revealing the association with milk fatty acids in a chinese holstein cattle population based on a post genome-wide association study
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4963957/
https://www.ncbi.nlm.nih.gov/pubmed/27468856
http://dx.doi.org/10.1186/s12863-016-0418-x
work_keys_str_mv AT licong geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT sundongxiao geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT zhangshengli geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT yangshaohua geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT alimma geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT zhangqin geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT liyanhua geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy
AT liulin geneticeffectsoffasnppargc1aabcg2andigf1revealingtheassociationwithmilkfattyacidsinachineseholsteincattlepopulationbasedonapostgenomewideassociationstudy